DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment calypso and ubh-1

DIOPT Version :9

Sequence 1:NP_611096.1 Gene:calypso / 36794 FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_504654.1 Gene:ubh-1 / 179039 WormBaseID:WBGene00006721 Length:216 Species:Caenorhabditis elegans


Alignment Length:243 Identity:60/243 - (24%)
Similarity:103/243 - (42%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LADGWLELESDPGLFTLLLKDFGCHDVQVEEV--YDLQKPIESPYGFIFLFRWIEERRARRKIVE 104
            :|..|..|||:|.:...:::..|...|:..:|  :|.:...:..:..|..|      ...:|:.|
 Worm     1 MAAPWTPLESNPSVINPMIEKMGVSGVKTVDVLFFDDESIGKPQHAVILCF------PEYKKVDE 59

  Fly   105 TTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGD-TLSRLKTHTKGMSPEN 168
            ....|:.:.:.|..|:||.:|.:.|:|.|.||...|.|. |:.:.||| :.::.....|.:..|.
 Worm    60 IMKPIYEQAKAADDSVFFMKQKISNACGTFALFHSLANL-EDRINLGDGSFAKWLAEAKKVGIEE 123

  Fly   169 KGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEA-FHFVSFVPINGQLFELDGLKP 232
            :...:.|..|||..|.:.|         ..|....|    |:. .||:.||..||.|:|:|..:|
 Worm   124 RSDFLANNAELAGIHAAAA---------TDGQTAPS----GDVEHHFICFVGKNGILYEIDSRRP 175

  Fly   233 YPMNHGGWEDSEDWTDKFRRVMAERLGIATGE-----QDIRFNLMAVV 275
            :....|...|:         .:.:..|.|...     .::.|:.:|||
 Worm   176 FAREIGPTSDA---------TLVKDAGAACQHLIEKLDNVSFSAIAVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 56/236 (24%)
ubh-1NP_504654.1 Peptidase_C12_UCH_L1_L3 5..212 CDD:187737 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.