DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lis-1 and wds

DIOPT Version :9

Sequence 1:NP_001246361.1 Gene:Lis-1 / 36791 FlyBaseID:FBgn0015754 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:317 Identity:94/317 - (29%)
Similarity:165/317 - (52%) Gaps:31/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLL 165
            ||:|.||..:::.|.|.|....:.|:|.|..|:||....|::|:::.||...:.|||:.:..:||
  Fly    65 KFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLL 129

  Fly   166 ASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKT 230
            .|.|.|.::|:|:.... :.:||:.||.:.|....|.|..:.::|.|.|.::::|:|.||.|:||
  Fly   130 VSGSDDKTLKVWELSTG-KSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKT 193

  Fly   231 YTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDC-KVELRDHEHTVECIAWAPEAAASAI 294
            ...|.:.|..|..:.:||:..:.|.|...|:|.|.|..| |..:.|....|..:.::|       
  Fly   194 LPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSP------- 251

  Fly   295 NEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFH---PGGKYLVS 356
                         .|.::.:.:.|.|:::||.|.|.||.|.:||.|....:..:   .|||::||
  Fly   252 -------------NGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVS 303

  Fly   357 ASDDKTIRVWDLRNKRCMKTLYAHQH--FCTSIDFHKAHPYVISGSV--DQTVKVWE 409
            .|:|..:.:|:|::|..::.|..|..  .||:.  |.....:.|.::  |:|:|:|:
  Fly   304 GSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTAC--HPTENIIASAALENDKTIKLWK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lis-1NP_001246361.1 LisH 9..40 CDD:128913
WD40 100..409 CDD:238121 93/315 (30%)
WD40 repeat 111..148 CDD:293791 11/36 (31%)
WD40 repeat 154..191 CDD:293791 12/36 (33%)
WD40 repeat 196..232 CDD:293791 13/35 (37%)
WD40 repeat 239..274 CDD:293791 11/35 (31%)
WD40 repeat 280..336 CDD:293791 12/55 (22%)
WD40 repeat 342..378 CDD:293791 10/38 (26%)
WD40 repeat 384..408 CDD:293791 7/25 (28%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 93/315 (30%)
WD40 repeat 75..112 CDD:293791 11/36 (31%)
WD40 repeat 118..154 CDD:293791 12/36 (33%)
WD40 repeat 159..195 CDD:293791 13/35 (37%)
WD40 repeat 202..237 CDD:293791 11/34 (32%)
WD40 repeat 244..280 CDD:293791 12/55 (22%)
WD40 repeat 288..325 CDD:293791 10/36 (28%)
WD40 repeat 331..357 CDD:293791 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D64718at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46811
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.