DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and PTP1

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:95/274 - (34%)
Similarity:132/274 - (48%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1126 KNRYADIFPYDKNRVILDIDAEGSDYINASFIDGHTRKKE-----YIATQGPKPESVMDFWRMIL 1185
            :|||.:|.||::|||.|. ...|:||||||::..:...:.     |||||||..::...||:|..
Yeast    55 RNRYVNIMPYERNRVHLK-TLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCY 118

  Fly  1186 QY----NVRVIVQVTQFREGNTIKCHEYYPYNVRGLTVTIKSK---------------------- 1224
            ..    |: |||.||...|.|..||::|:|......||.|.||                      
Yeast   119 HNCPLDNI-VIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFV 182

  Fly  1225 ---EVLELYDRTE--LTVVHDKYGLKEKVIHYYFKKWPDHGVPEDPMHLIMFVKKVKAEKRPSYS 1284
               :|.:.|..|:  ||......|..:.|.|:||..|.|...||:    ::.:.::.|......|
Yeast   183 NVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEE----VVPIMELCAHSHSLNS 243

  Fly  1285 ---PIVVHCSAGVGRTGTFIGLDLIM----------QRLKSESKIN-------IFETVKKLRFQR 1329
               ||:||||||||||||||.||.:|          :|.:...:..       |.:.|.:||.||
Yeast   244 RGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQR 308

  Fly  1330 MKMVQTQQQYTFLY 1343
            ||||||:.|:.|:|
Yeast   309 MKMVQTKDQFLFIY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 95/274 (35%)
PTPc 1125..1348 CDD:238006 95/274 (35%)
PTP1NP_010051.1 COG5599 1..335 CDD:227886 95/274 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.