DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and PTP1

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_001031266.1 Gene:PTP1 / 843516 AraportID:AT1G71860 Length:340 Species:Arabidopsis thaliana


Alignment Length:281 Identity:94/281 - (33%)
Similarity:158/281 - (56%) Gaps:34/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1090 IFYTEVAKPEKLAREFKEI-------TVVALELSYSASELGCHKNRYADIFPYDKNRVILD--ID 1145
            :|..::..|:.:|.||..:       :.:.|..:.:.:.:...||||:|:.|:||||::|:  .|
plant    47 VFRGKIQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCKD 111

  Fly  1146 AEGSDYINASFIDGHTRKKE----YIATQGPKPESVMDFWRMILQYNVRVIVQVTQFREGN-TIK 1205
            :....|:|||.|  .|.:.|    :||||||.|.::.|||.|::|.:..:||.:|:..:.| |:|
plant   112 SSAKGYVNASLI--KTSESESISQFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVDNNRTVK 174

  Fly  1206 CHEYY-----PYNVRGLTVTIKSKEVLELYDRTELTVVHDKYGLKE------KVIHYYFKKWPDH 1259
            |.:|:     |.....:::|.|..:..:    |.|.:.:.:...||      .|:|..:.:||||
plant   175 CGDYFQDEDGPREFGNISLTTKWIKTTD----TSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDH 235

  Fly  1260 GVPEDPMHLIMFVKKVKAEKRPSYSPIVVHCSAGVGRTGTFIGLDLIMQRLKS--ESKINIFETV 1322
            |||:|.:.:...:|:: .:..||..||:||||||:|||||:..:...:||:.:  .|.:::.:||
plant   236 GVPKDTVAVREILKRL-YQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTV 299

  Fly  1323 KKLRFQRMKMVQTQQQYTFLY 1343
            ...|.||:.||||..||.|.|
plant   300 ALFRKQRIGMVQTMDQYFFCY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 92/271 (34%)
PTPc 1125..1348 CDD:238006 88/239 (37%)
PTP1NP_001031266.1 PTPc_plant_PTP1 117..321 CDD:350496 76/211 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2866
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19134
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.