DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and PTPRD

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_001364887.1 Gene:PTPRD / 5789 HGNCID:9668 Length:1932 Species:Homo sapiens


Alignment Length:1448 Identity:324/1448 - (22%)
Similarity:548/1448 - (37%) Gaps:363/1448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PKTTVTSVV--ATANTIKVTWQTNDRACVESFGITAKATDYTKSFQLLNDKSSQTF--VNLSACL 189
            ||...|.||  :||.:|.:||.:.:...|..:.|..|..:..:.::.::..::..:  ..||...
Human   323 PKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKPKNSEELYKEIDGVATTRYSVAGLSPYS 387

  Fly   190 THTITLDTRNNASVVVDTDATDVDTQYAEPGDLVMNV--TNLASGITMITWGDPSEKN-CISNY- 250
            .:...:...||......::.....|....|.....:|  ..|:|...::.|.:|.|.| .|..| 
Human   388 DYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYR 452

  Fly   251 ----------VFKWQRNDCGTDQNQDTT-----------------TDVPSTETTNEIDYVTTT-- 286
                      |..|.:::..  .:|.||                 |.:.....:::|..:|.|  
Human   453 VYYTMDPTQHVNNWMKHNVA--DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGV 515

  Fly   287 ---PMETTPDTPSD-EVKCEWTD-----------VSSDGKLRE-----------YLLTDLQGCDL 325
               |:....:..|: .:...||.           |..||:..|           |.|..|:...|
Human   516 PGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSL 580

  Fly   326 YTFQVFINENSTAKASQTFTSAEKLVSA-VYEPSPTAYPTQLHWT----------WFSP--QNHP 377
            |.|::      .|::.|...::...:|| ..:..|:|.|..:..|          |..|  :...
Human   581 YYFRL------AARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQN 639

  Fly   378 KCVANYSVTLTGPIQRSENKTMNVI---TEETFAIFDDLDPCGIYLVEIVPNQLNGSAGTKYQEQ 439
            ..:..||:..|. :...::|...::   ::.|..:.:.|:....|.:.:..:...|.........
Human   640 GIITEYSIKYTA-VDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVL 703

  Fly   440 STVGEDQPSVIQDP--VVEAEAY---SMEVSWKTP----EYADLCIDGYRL-------------- 481
            ....||.||   .|  .||.||.   |::|||::|    ::..  |.||::              
Human   704 IRTNEDVPS---GPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQ--IRGYQVHYVRMENGEPKGQP 763

  Fly   482 ---------SGWMEDDKLVEVEALSITTQNTTVVFDKNLLACQVYIIQIIPYTKENLDGQLRQVG 537
                     :.|..||          ||::..::  ..|.....|.:.:..||.:....:.:...
Human   764 MLKDVMLADAQWEFDD----------TTEHDMII--SGLQPETSYSLTVTAYTTKGDGARSKPKL 816

  Fly   538 VETKAA-------IVDYTKVKLEMKNAGSEFIDLIAFNADYNNSCPTIFALFTCNATTQVRNPYA 595
            |.|..|       ::::|    :|..|      ||.::...:...|                   
Human   817 VSTTGAVPGKPRLVINHT----QMNTA------LIQWHPPVDTFGP------------------- 852

  Fly   596 ERYVEGHSKQGFNASLSPLSPY-----------------ATYVCKVILYNVAGPSEPVVDADMHT 643
               ::|:..:.....:.||:..                 |:||.::...|..|..|     :|..
Human   853 ---LQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNKVGFGE-----EMVK 909

  Fly   644 TTYFPEQ-----PESVMLEKSTVSSLLFNWQPPTYT--NGPIKYYQAFLMRHEASYFVPADCAIV 701
            ....||:     |:::..|.:|.:|:..:||||...  ||.|..| ..|.|......:|.:..||
Human   910 EISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKY-TLLYRDINIPLLPMEQLIV 973

  Fly   702 EQDTKSETKGDPSVNFTGLAPAVRYMMQVAAQNDFGMGVYTEPVIGITLPAVSDSVTQLTVLTQG 766
            ..||        ::..|||.|...|.::|.|....|.|.|:..|...|||     |.|.......
Human   974 PADT--------TMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLP-----VDQAVFAKNF 1025

  Fly   767 PVNNNAVYEANVTITWKVPCKSNGDIEYFQLAFNGTRNNFAPVSFERRVELDTGNKQGRMSYTET 831
            .|  .||.:.:|.::|::|...|..:.:..|..:|           :.||...|....::.   .
Human  1026 HV--KAVMKTSVLLSWEIPENYNSAMPFKILYDDG-----------KMVEEVDGRATQKLI---V 1074

  Fly   832 EMQPQFDYTVEVSVKNRDVEQLSSSVPGSWQSPAGLPTIPSDELIKQMRANVEETSNPTKTAIVR 896
            .::|:..|:..::  ||      .:..|..|......|.|  ::::...|.:.:| |......|:
Human  1075 NLKPEKSYSFVLT--NR------GNSAGGLQHRVTAKTAP--DVLRTKPAFIGKT-NLDGMITVQ 1128

  Fly   897 LPADIMTSASGDIK-WMALMISQKNCAGVPHLKYDVSSDWPKVLSYQEAGADGTGDCSLEYQTTE 960
            ||.   ..|:.:|| :..:::..|...|    |:....:.|..:...|.                
Human  1129 LPE---VPANENIKGYYIIIVPLKKSRG----KFIKPWESPDEMELDEL---------------- 1170

  Fly   961 ERWHPEPVQRQRRDGEVTSDEEI-------------VFTIGLDKCSEVQKTYCNGPLLPDTDYNV 1012
                .:.:.|:||......:.|:             .||:|.||   ....:.|..|....:|..
Human  1171 ----LKEISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDK---HYGGFTNKQLQSGQEYVF 1228

  Fly  1013 VV---------RLFTASGYSDAAV--------LNFKTKAAIKVT--LILVSVCSCLLLAFVLGLT 1058
            .|         :::..|.|||..|        :..:.:..|.|.  ::.|....|:::|.:|..:
Human  1229 FVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEEGLIWVVGPVLAVVFIICIVIAILLYKS 1293

  Fly  1059 VLWVRKRLAWKRDSGQGI------------EDPF------------------GNVIAKNFAIF-- 1091
            ....|||.  :.||.:..            .||.                  ||:.:.:.|..  
Human  1294 SKPDRKRA--ESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPGSDDSGYPGNLHSSSMASHPP 1356

  Fly  1092 --------YTEVAKPE---KLAREFKEITV-VALELSYSASELGCHKNRYADIFPYDKNRVILDI 1144
                    :.|..|..   |.::|::.|.. ......:|..|:...|||||::..||.:||:|..
Human  1357 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSA 1421

  Fly  1145 --DAEGSDYINASFIDGHTRKKEYIATQGPKPESVMDFWRMILQYNVRVIVQVTQFREGNTIKCH 1207
              ...||||:||::|||:.::..||||||..||:..||||||.:.....:|.:|:..|.:.:||.
Human  1422 IEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCD 1486

  Fly  1208 EYYP---YNVRGLTVTIKSKEVLELYDRTELTVVHDKYGLKEK--VIHYYFKKWPDHGVPEDPMH 1267
            :|:|   ....|| |.:...:.:||......|....|.|..||  |..:.|..||||||||.|..
Human  1487 QYWPSRGTETHGL-VQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTP 1550

  Fly  1268 LIMFVKKVKAEKRPSYSPIVVHCSAGVGRTGTFIGLDLIMQRLKSESKINIFETVKKLRFQRMKM 1332
            .:.|:::||....|...|:||||||||||||.||.:|.:::|:|.|..::|:..|..:|.||..|
Human  1551 FLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYM 1615

  Fly  1333 VQTQQQYTFLYACTYELV 1350
            |||:.||.|::....|.|
Human  1616 VQTEDQYIFIHDALLEAV 1633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020 32/107 (30%)
PTPc 1100..1345 CDD:214550 101/252 (40%)
PTPc 1125..1348 CDD:238006 96/229 (42%)
PTPRDNP_001364887.1 I-set 24..115 CDD:400151
Ig strand A' 32..36 CDD:409353
Ig strand B 39..48 CDD:409353
Ig strand C 54..59 CDD:409353
Ig strand C' 62..65 CDD:409353
Ig strand D 68..75 CDD:409353
Ig strand E 76..86 CDD:409353
Ig strand F 94..102 CDD:409353
Ig strand G 105..115 CDD:409353
IgI_2_RPTP_IIa_LAR_like 127..226 CDD:409400
Ig strand B 143..147 CDD:409400
Ig strand C 156..160 CDD:409400
Interaction with IL1RAPL1. /evidence=ECO:0000250 180..189
Mini-exon peptide A9, sufficient for interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:Q64487 181..189
Ig strand E 190..194 CDD:409400
Ig strand F 204..209 CDD:409400
Ig strand G 216..219 CDD:409400
Mini-exon peptide B, required for interaction with SLITRK2 and in the function in pre-synaptic differentiation, Acts as an adjustable linker to control relative positions and orientations of the PTPRD second and third immunoglobilin domains for their simultaneous interactions with the first immunoglobilin domain of IL1RAPL1 and IL1RAP, Modulates affinity for IL1RAPL1 and IL1RAP. /evidence=ECO:0000250|UniProtKB:Q64487 227..230
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401
Ig strand B 253..257 CDD:409401
Ig strand C 266..270 CDD:409401
Ig strand E 287..291 CDD:409401
Ig strand F 299..304 CDD:409401
Ig strand G 312..315 CDD:409401
FN3 323..412 CDD:238020 17/88 (19%)
FN3 419..511 CDD:238020 16/93 (17%)
FN3 516..604 CDD:238020 18/93 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..623 4/19 (21%)
FN3 612..706 CDD:238020 12/94 (13%)
FN3 713..819 CDD:238020 23/119 (19%)
FN3 824..919 CDD:238020 18/131 (14%)
FN3 922..1013 CDD:238020 30/99 (30%)
FN3 1023..>1084 CDD:238020 14/76 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1304..1324 2/19 (11%)
R-PTPc-D-1 1354..1637 CDD:350472 105/281 (37%)
Substrate binding. /evidence=ECO:0000250 1573..1579 5/5 (100%)
R-PTP-D-2 1638..1929 CDD:350476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.