DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and pyp1

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_594885.1 Gene:pyp1 / 2542677 PomBaseID:SPAC26F1.10c Length:550 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:93/267 - (34%)
Similarity:126/267 - (47%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 SASELGCHKNRYADIFPYDKNRVILDIDAEGS-DYINASFIDGHTRKKEYIATQGPKPESVMDFW 1181
            |.|.....||||.||.||:..||.|...:... ||||||||  .|....|||.||....|:.|||
pombe   290 SLSNTSYKKNRYTDIVPYNCTRVHLKRTSPSELDYINASFI--KTETSNYIACQGSISRSISDFW 352

  Fly  1182 RMILQ--YNVRVIVQVTQFREGNTIKCHEYYPYNVRGLTVTIKSKEVLELY---DRTELTVVHDK 1241
            .|:..  .|:..||.:....|.....|..|:|.|      .|..|:|...|   ..:|..|.:.:
pombe   353 HMVWDNVENIGTIVMLGSLFEAGREMCTAYWPSN------GIGDKQVYGDYCVKQISEENVDNSR 411

  Fly  1242 YGLK------------EKVIHYYFKKWPDHGVPEDPMHLIMFVKKVKAEKRPSYSPIVVHCSAGV 1294
            :.|:            :||.||.:..|.|...||:...::.|:|.|........:  :|||||||
pombe   412 FILRKFEIQNANFPSVKKVHHYQYPNWSDCNSPENVKSMVEFLKYVNNSHGSGNT--IVHCSAGV 474

  Fly  1295 GRTGTFIGLDLIMQRLKSESKIN------------IFETVKKLRFQRMKMVQTQQQYTFLYACTY 1347
            |||||||.||.|::  ..|||::            :|:.|..:|.||||||||..|:.::|....
pombe   475 GRTGTFIVLDTILR--FPESKLSGFNPSVADSSDVVFQLVDHIRKQRMKMVQTFTQFKYVYDLID 537

  Fly  1348 ELVKHKI 1354
            .|.|.::
pombe   538 SLQKSQV 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 91/256 (36%)
PTPc 1125..1348 CDD:238006 89/252 (35%)
pyp1NP_594885.1 RHOD 41..161 CDD:294087
COG5599 244..548 CDD:227886 93/267 (35%)
PTPc 297..536 CDD:238006 89/250 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.