DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and pyp3

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_594934.1 Gene:pyp3 / 2541443 PomBaseID:SPAC11E3.09 Length:303 Species:Schizosaccharomyces pombe


Alignment Length:309 Identity:109/309 - (35%)
Similarity:156/309 - (50%) Gaps:53/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1075 GIEDPFGNVIAKNFAIFYTEVAKPEKLAREFKEITVVALELSYSASELGCHKNRYADIFPYDKNR 1139
            |:..|...:..|.:.|.       |.|..|  ||.::...|. ..|:....:|||::|.||:..|
pombe    11 GVLTPLITIKEKAYMII-------EGLNEE--EIELLNTRLP-KLSKKALARNRYSNIVPYENTR 65

  Fly  1140 VILD-IDAEGSDYINASFI---DGHTRKKEYIATQGPKPESVMDFWRMILQYNVR--VIVQVTQF 1198
            |.|| :..|..||||||.:   .|    |.:||||||...|:..||:|:.|...:  :||.:|:.
pombe    66 VRLDPMWKEACDYINASIVKIPSG----KTFIATQGPTSNSIDVFWKMVWQSVPKSGIIVMLTKL 126

  Fly  1199 REGNTIKCHEYYP------YNVRGLTVTIKSKEVLELYDRTELTVVH------DKYGLKEKVIHY 1251
            ||.:.:||..|:|      .|:..|:|.:     :::|..|.|..|.      :|.|:|:|::|:
pombe   127 RERHRLKCDIYWPVELFETLNIGDLSVIL-----VKVYTLTSLNEVQVREFELNKDGVKKKILHF 186

  Fly  1252 YFKKWPDHGVPEDPMHLIMFVKKVKAEKRPSYS------PIVVHCSAGVGRTGTFIGLDLIMQRL 1310
            |:..|||.|.|    |....:...:..|..|||      ||:||||||.||||||:.|..|:.:.
pombe   187 YYNGWPDFGAP----HTFSLLSLTRYIKSLSYSPDFETAPIIVHCSAGCGRTGTFMALFEILSQT 247

  Fly  1311 ---KSESKI---NIFETVKKLRFQRMKMVQTQQQYTFLYACTYELVKHK 1353
               .|.||.   ||...|..||.|||:.||:..|..|||..:.||::.|
pombe   248 DDSTSTSKFEVDNIANIVSSLRSQRMQSVQSVDQLVFLYTVSQELLQGK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 101/274 (37%)
PTPc 1125..1348 CDD:238006 95/252 (38%)
pyp3NP_594934.1 COG5599 1..303 CDD:227886 109/309 (35%)
AbiGii_2 <18..69 CDD:293478 17/60 (28%)
PTPc 52..291 CDD:238006 95/251 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0791
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47137
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.