DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and ZK484.7

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_491758.1 Gene:ZK484.7 / 191327 WormBaseID:WBGene00022753 Length:344 Species:Caenorhabditis elegans


Alignment Length:273 Identity:91/273 - (33%)
Similarity:129/273 - (47%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 EKLAREFKEITVVALELSYSASELGCHKNRYADIFPYDKNRVILDIDAEGSDYINASFIDGHTRK 1163
            ||: :.|||           |.|.|  ||||.|:...|.|||.|. .....|||:|:|:...:..
 Worm    69 EKM-KAFKE-----------AQEHG--KNRYKDVGCLDHNRVKLH-PPWPHDYIHANFVSTPSNP 118

  Fly  1164 KEYIATQGPKPESVMDFWRMILQYNVRVIVQVTQFREGNTIKCHEYYPYNVRGLTVTIKSKEVLE 1228
            :.:|.||.|..:|..|||.|.||..|..|..:....|....||.:|:         ..|.|.|||
 Worm   119 RRFICTQAPLDKSCADFWYMCLQEKVDSIFMLCNIMEKGAKKCCDYF---------ACKDKPVLE 174

  Fly  1229 LYDR------------------------TE-LTVVHDKYGLKEKVIHYYFKKWPDHGVPEDPMHL 1268
            ..::                        || :..|....||.:||..|::..|||.|||...|.:
 Worm   175 FEEKGHKIIVKFESTGKMKFEKNTDAKITETVFTVEGPGGLAQKVTQYHWIDWPDRGVPTADMAI 239

  Fly  1269 IMFVKKVKAEKRPSYSPIVVHCSAGVGRTGTFIGLDLIMQRLKSESKINIFET---VKKLRFQRM 1330
            :    ::.|:.|||..|.|||||||:||||:.:.::.|:.:|....:|.  ||   ::|:|.||.
 Worm   240 V----ELLAKTRPSKGPTVVHCSAGIGRTGSVVMIEYILDQLLGGQQIE--ETDKILQKIREQRN 298

  Fly  1331 KMVQTQQQYTFLY 1343
            ..:||.|||.|::
 Worm   299 NSIQTDQQYLFVH 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 90/272 (33%)
PTPc 1125..1348 CDD:238006 83/247 (34%)
ZK484.7NP_491758.1 Y_phosphatase 80..316 CDD:278528 84/250 (34%)
PTPc 81..316 CDD:238006 84/249 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.