DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and ZK354.8

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_500775.1 Gene:ZK354.8 / 191295 WormBaseID:WBGene00022709 Length:483 Species:Caenorhabditis elegans


Alignment Length:269 Identity:86/269 - (31%)
Similarity:135/269 - (50%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1101 LAREFKEITVVALELSYSASELG-CHKNRYADIFPYDKNRVILDIDAEGSDYINASFIDGHTRKK 1164
            |.:|:::....|.| ..:.|.|| ..:|||.:|...|..||.|..|..  .||:|:.:......:
 Worm   201 LKKEYRDSPNEAPE-DIATSFLGNPTRNRYRNIPCCDITRVKLTDDPH--FYIHANLVSSGPNPR 262

  Fly  1165 EYIATQGPKPESVMDFWRMILQYNVRVIVQVTQFREGNTIKCHEYYPYNV-------RGLTVTIK 1222
            .:|.||.|...::.:||:||:...:..||.:.:..|....|..||:|..:       |..|||.:
 Worm   263 RFICTQAPLNGTIEEFWKMIIVTGIEYIVMLCELVEKGKPKSAEYFPSQIGQTTKIGRLCTVTKE 327

  Fly  1223 SKEVLELYDRTEL--TVVHDKYG---LKEKVIHYYFKKWPDHGVPED---PMHLIMFVKKVKAEK 1279
            |:..:   |:|.:  |:...|.|   :.:.|.|.:::.|||||||::   |..|:..||...   
 Worm   328 SRVDI---DKTLVMSTMRISKPGDNAVVKIVKHIHWRNWPDHGVPDNFLSPFRLLTVVKNCT--- 386

  Fly  1280 RPSYSPIVVHCSAGVGRTGTFIGLDLIMQRLKSESKINIFETVKKLRFQRMKMVQTQQQYTFLYA 1344
                .|||||||||||||||...:.:|::.:.....|.:...:.|||.:|.:.|||:.||.:.:.
 Worm   387 ----KPIVVHCSAGVGRTGTLALILIILESICLPDFIGVPRLLAKLREERFRAVQTEMQYLYAHR 447

  Fly  1345 CTYELVKHK 1353
            |..|.:..|
 Worm   448 CVLEYLALK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 83/259 (32%)
PTPc 1125..1348 CDD:238006 77/237 (32%)
ZK354.8NP_500775.1 PTPc 200..451 CDD:214550 84/262 (32%)
PTPc 225..451 CDD:238006 77/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.