DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and B0280.11

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_498560.2 Gene:B0280.11 / 175997 WormBaseID:WBGene00015106 Length:441 Species:Caenorhabditis elegans


Alignment Length:299 Identity:67/299 - (22%)
Similarity:121/299 - (40%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1093 TEVAKPEKLAR-------EFKEITVVALEL----------SYSASELGCHKNRYADIFPYDKNRV 1140
            |.|.:.|||..       :||.|..:.::|          .|..||         ::..||.|||
 Worm   127 TWVEQLEKLVEIRKLLEADFKPIDTMKVDLEKCQAFKKNIDYCQSE---------NVELYDANRV 182

  Fly  1141 ILDIDAEGSDYINASFIDGHTRKKEYIATQGP---KPESVMDFWRMILQYNVRVIVQVTQFREGN 1202
            ....:|:...:...:.|...:.|...:| |.|   .|.|:..||.|:....::.:..:....|.:
 Worm   183 KGGGEADFFYHATVTSIPSISTKSTILA-QLPLSDSPHSLESFWLMVAAQKIQRLFILIGEDELD 246

  Fly  1203 TIKCHEYYPYNVRGL-TVTIKSKEVLELYDRTELTVVHDKYGLKE---------KVIHYYFKKWP 1257
            .....||:|.:.:.. |:.:.:::.:...|....|.::.:...|:         ::..:    ||
 Worm   247 KAALSEYFPEDFKEFKTIRVNNRKTVSKSDEQPNTQLYYEVVPKDCAEAPFAMIEICDF----WP 307

  Fly  1258 DHGVPEDPMHLI------MFVKKVKAEKRPSYSPIVVHCSAGVGRTGTF-IGLDLIMQRLKSESK 1315
            |..:|......|      :|...:.::     :...:..:.|.||.|:| :|:..| ::|::...
 Worm   308 DGKIPTVSYGRIAATAASVFDSDIDSD-----ATCAIVSNYGAGRAGSFLVGVQAI-EKLQAGDA 366

  Fly  1316 INIFETVKKLRFQRMKMVQTQQQYTFLY--ACTYELVKH 1352
            .||.|....:|.||...::|..||.|.|  |.||.| ||
 Worm   367 PNIKEIAMSIRSQRPCAIETLPQYVFTYIIALTYGL-KH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 58/283 (20%)
PTPc 1125..1348 CDD:238006 51/244 (21%)
B0280.11NP_498560.2 PTPc 141..398 CDD:214550 56/276 (20%)
PTPc 177..394 CDD:304379 48/227 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.