DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp52F and egg-5

DIOPT Version :9

Sequence 1:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_491316.1 Gene:egg-5 / 172007 WormBaseID:WBGene00020035 Length:753 Species:Caenorhabditis elegans


Alignment Length:361 Identity:78/361 - (21%)
Similarity:125/361 - (34%) Gaps:105/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1104 EFKEITVVALELSYSASELGCHKNRYADIFPYDKNRVILDIDAEG---SDYINASFIDGHTRKKE 1165
            |..|.:|..:..::|||:....|.|...:...|..|:.|.. ..|   .|:|:|:.|.|.....|
 Worm   413 EILENSVNHIPFTHSASDNNQEKCRNPRVHCRDSTRIALQF-PRGQYLGDFIHANRISGKPLFNE 476

  Fly  1166 YIATQGPKPESVMDFWRMILQYNVRVIVQVTQFREGNTIKCHEYYPYNVRGLTVTIKSKEVLELY 1230
            :|.||.|...:|.|||||:.|..|..||.:|..:|..  :|..|:|.:.....||:.....:|.:
 Worm   477 FIMTQAPMKNTVDDFWRMVWQEEVPYIVMLTSRKEPE--RCEYYWPKSPSDPAVTVPGGLRIENF 539

  Fly  1231 --------------------DRTELTVVHDKYGLKEKVIHYYFKKWPDHGVPEDPMHLIMFVKKV 1275
                                ||.|..|.|.:..:......|            .|::::..:   
 Worm   540 GVYQAPDPLFRVTHLRLIGPDREERHVEHWQGDVNNSSNMY------------SPLNILRLL--- 589

  Fly  1276 KAEKRPSYSPIVVHCSAGVGRTGTFIGLDL-IMQRLKSES-KINIFETVKKLRFQRMKMVQTQQQ 1338
                |.:..|:|:|...||.|....:..:: |...|:..: |..:...|:.||.:|...::|..|
 Worm   590 ----RNASKPVVIHDHLGVSRAACLVAAEIAICSLLRGPTYKYPVQRAVQFLRQRRPFSIETPMQ 650

  Fly  1339 YTFLYACT----------------------------------------YELVKHKIPRAALKMDG 1363
            |.|::...                                        |.|:..:.....::|.|
 Worm   651 YIFVHRLVAFFFRDVIGSAKELDVDYERWLQERSERMFLDDLAAPIPGYRLLSPRADPDIVRMVG 715

  Fly  1364 RP------------------KSVTVPAIPSPKKVSF 1381
            ||                  |...|..|.||.|..|
 Worm   716 RPERPNYRREAPDCVGEMPNKVAAVDGILSPAKSVF 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 65/265 (25%)
PTPc 1125..1348 CDD:238006 59/287 (21%)
egg-5NP_491316.1 PTPc 407..660 CDD:214550 65/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.