DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and AT1G25988

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_173933.1 Gene:AT1G25988 / 839149 AraportID:AT1G25988 Length:180 Species:Arabidopsis thaliana


Alignment Length:160 Identity:37/160 - (23%)
Similarity:67/160 - (41%) Gaps:37/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KTDPQNTDYEIEAGATRNF----------MAL-------KLAEEQARREEQE--LRDEEANNPMK 135
            ||||||.:|.|.:||.:..          |.|       |||:...|.|.||  |:.::|..|..
plant    27 KTDPQNCEYVITSGAQKKVEEYEAEDAETMELTAEQEKGKLADPFYRLEHQEVDLQKKKAAEPFL 91

  Fly   136 LLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYN------------TVETERERQER 188
            :...|...:|:...|.::....|...:..:..:.:...::..            .:|.|:....|
plant    92 VRLQRVSDARHADGTQKTCSRRRGCFKEARLGEKSDFFERVKKILRLPQTLLGVIIEQEKNGAGR 156

  Fly   189 EEREDEDFIKSVNFKNKPEGSSRVVAEEII 218
            :|:|:.   :|::.|: .||  |:.:..|:
plant   157 KEKENN---RSISIKS-TEG--RIQSFSIV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 26/98 (27%)
DUF572 8..>177 CDD:282371 26/105 (25%)
AT1G25988NP_173933.1 DUF572 <27..>104 CDD:282371 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.