DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and AT3G43250

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_189911.1 Gene:AT3G43250 / 823400 AraportID:AT3G43250 Length:249 Species:Arabidopsis thaliana


Alignment Length:241 Identity:101/241 - (41%)
Similarity:148/241 - (61%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |.|||.|||||||||||.||.|:|..||:|..:|.|.|..:||.|||.|:.:|.|||.|:|||..
plant     1 MGERKNLNKYYPPDFDPKKIHRIKKPKNQQKKIRFMLPVRVRCNTCGNYMSEGTKFNCRQEDVIT 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |||||::|:|||||||:||.|::.||||:|..|.:|:||:..:...:..||:.:::.:       
plant    66 ETYLGLKIHRFYIKCTKCLAELTIKTDPKNHSYTVESGASCLYNGHEDIEEEKKKKHE------- 123

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
             |.::.|||||..|:.|||.:.||:||:.:..|:.::..:.:|:..    :.|::||.|..|:|.
plant   124 -NALESLENRTVVSKREIEVMASLDELKSMKSRRASLSVDYMLEDL----SRRKKQEEENVEEEL 183

  Fly   196 FIKSVNFKNKPEGSSRVVAEEIIEEIKD-EPLDTPSAPPPAKQAKP 240
            .|||:.|      ..|:..:|  |:.|: |..|...    .|:.||
plant   184 LIKSIKF------GKRIRTDE--EKKKNYEAFDEKK----KKKKKP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 77/162 (48%)
DUF572 8..>177 CDD:282371 77/168 (46%)
AT3G43250NP_189911.1 DUF572 9..>174 CDD:398281 77/176 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 1 1.000 - - FOG0002595
OrthoInspector 1 1.000 - - otm3495
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12111
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.