DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and YJU2B

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001307490.1 Gene:YJU2B / 81576 HGNCID:28118 Length:396 Species:Homo sapiens


Alignment Length:411 Identity:109/411 - (26%)
Similarity:167/411 - (40%) Gaps:95/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYT-----------------VRLMAPFNMRCKTCGE 48
            |.|||.:||||||||:|.|...:    ||.:.                 :|...|:|:.|..|..
Human     1 MGERKGVNKYYPPDFNPEKHGSL----NRYHNSHPLRERARKLSQGILIIRFEMPYNIWCDGCKN 61

  Fly    49 YIYKGKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKL 113
            :|..|.::||.|:.|.|  |....||||.:||..|:..|..:|||.|.||.|.:||.|......:
Human    62 HIGMGVRYNAEKKKVGN--YYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGAQRKEERWDM 124

  Fly   114 AE-EQARREEQELRDEEANNPMKLLEN-RTQQS--RNEIETIESLEELRDLNRRQQTVDYNTLLQ 174
            |: ||....|.|.:.:...:.|..||: ...:|  :..:.|:..::|.:  :..:.....|::|:
Human   125 ADNEQVLTTEHEKKQKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQ--SAWKDDFALNSMLR 187

  Fly   175 QYNTVETERERQEREEREDEDFIK-SVNFKNKPEGSSRVVAEEIIEEIKDEPLDT---------- 228
            : ...|.::..||.|||:.....| |:.....||...   ..::...:|...||:          
Human   188 R-RFREKKKAIQEEEERDQALQAKASLTIPLVPETED---DRKLAALLKFHTLDSYEDKQKLKRT 248

  Fly   229 --------PSAPPPAKQAKPSTISLSATSSSKASAAQS--------MVKRKTPLVLVKPKATAVA 277
                    ||||..|..:|.|.:......|.:.:.|.|        :|:|::..|   |::...|
Human   249 EIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALATSPITVGDLGIVRRRSRDV---PESPQHA 310

  Fly   278 KPTVATGTTQVESKPAATTP-SVVSAPAETKAT-----------------------NQPAA---- 314
            ..|..:|..:|..:.|...| |....|.||..|                       :|.||    
Human   311 ADTPKSGEPRVPEEAAQDRPMSPGDCPPETTETPKCSSPRGQEGSRQDKPLSPAGSSQEAADTPD 375

  Fly   315 ----APAGLSLLAAYSDSSED 331
                ...|.||:|.||||..:
Human   376 TRHPCSLGSSLVADYSDSESE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 54/183 (30%)
DUF572 8..>177 CDD:282371 56/189 (30%)
YJU2BNP_001307490.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 15/28 (54%)
DUF572 8..221 CDD:309584 65/221 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..396 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2441
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.