DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and yju2b

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_991158.2 Gene:yju2b / 402887 ZFINID:ZDB-GENE-040912-36 Length:390 Species:Danio rerio


Alignment Length:418 Identity:107/418 - (25%)
Similarity:163/418 - (38%) Gaps:116/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIP-----------RMKLAKNRQ--YTVRLMAPFNMRCKTCGEYIYK 52
            |.|||.:||:|||||||:|..           |.:..|..|  ..:|...|:|:.|..|..:|..
Zfish     1 MGERKGVNKWYPPDFDPAKHGSINGYYKTHPLRERARKLSQGILIIRFEMPYNIWCDGCKNHIGM 65

  Fly    53 GKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAE-E 116
            |.::||.|:.|.|  |....||||.:||..|:..|..:|||...||.|.:||.|......:|| |
Zfish    66 GVRYNAEKKKVGN--YYTTPIYRFRMKCHLCVNYIEMQTDPATCDYVIVSGAQRKEERWDMAENE 128

  Fly   117 QARREEQELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVET 181
            |....|:..:::...:.|..|::..:........|.||.||                        
Zfish   129 QILTTERNEKEKLETDAMYKLDHGGKDKEKLRAAIPSLNEL------------------------ 169

  Fly   182 ERERQEREEREDEDFIKSVNFKNKPEGSSRVVAEE-----------------IIEEIKDEPL--- 226
                ||.:....:||..:...:.|.....:|:|||                 :.|..:|:.|   
Zfish   170 ----QEHQSGWKDDFQLNSALRRKFRTEKKVIAEEEEKDNAVRLRTGLSIPLVPEREEDKKLASL 230

  Fly   227 ---DTPSAPPPAKQAKPSTIS----LSATSSSKASAAQSMVKR------------------KTPL 266
               .:|.:....||.|...||    .::.||:...||.|::::                  .|..
Zfish   231 LTFQSPDSYEDKKQWKRQEISSRSWFNSPSSAAGGAAGSLLQKLGQQGRGAAVAKALSSSTSTLP 295

  Fly   267 VLVKPKATAVAKPTVATGTT--QVESKPAA------TTPSVVS-------------------APA 304
            :||:.|:.:....|..|.:|  .|::.|||      ..||:|:                   |.:
Zfish   296 ILVRRKSESSKSETNNTMSTILPVDTHPAAKDTDATDLPSIVNNINVSINTDINSCTTDACKASS 360

  Fly   305 ETKATNQPAAAPAGLSLLAAYSDSSEDS 332
            .::..|...:...|.||:|.||||...|
Zfish   361 SSEEENSIDSCATGKSLVADYSDSDSGS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 55/176 (31%)
DUF572 8..>177 CDD:282371 55/182 (30%)
yju2bNP_991158.2 COG5134 7..231 CDD:227463 67/253 (26%)
DUF572 8..238 CDD:282371 68/259 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..390 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2441
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.