DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and CG15084

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_611383.1 Gene:CG15084 / 37178 FlyBaseID:FBgn0034402 Length:316 Species:Drosophila melanogaster


Alignment Length:363 Identity:88/363 - (24%)
Similarity:145/363 - (39%) Gaps:78/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQ------------YTVRLMAPFNMRCKTCGEYIYKG 53
            |.|||..|||||||:||.|....|......            ..:|...|:|:.|..|..:|..|
  Fly     1 MGERKGQNKYYPPDYDPKKGGLNKFQGTHALRERARKIHLGIIIIRFEMPYNIWCDGCKNHIGMG 65

  Fly    54 KKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMAL-KLAEEQ 117
            .::||.|..|  ..|....:::|.:||..|......:|||.|.||.|.:||.|..... .|..||
  Fly    66 VRYNAEKTKV--GMYYTTPVFKFRMKCHLCDNHFEIQTDPGNLDYVILSGARRQENRWDPLQNEQ 128

  Fly   118 ARREEQELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETE 182
            ...|.:|::....::.|..||::.:.::...:....|::|         |:.|..:...:.:...
  Fly   129 VVPETKEVQKRLFDDAMYKLEHQAKDAKAGADARPVLQKL---------VERNMSVWDDSYMANS 184

  Fly   183 RERQEREEREDEDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSA 247
            |.|.|..:::     |.:|  .:.|...:::|:        ..||....|...:..:.:.:....
  Fly   185 RLRAEFRQQK-----KEIN--GQQELDRQLLAK--------SSLDIALLPETTQDREMAALMKLQ 234

  Fly   248 TSSSKASAAQSMVKRKTPLVLVKPKATAVAKPTVATG---------TTQVE--------SKPAAT 295
            |.|:....::..::     :|::|   |:...||.|.         .||::        .|...|
  Fly   235 TKSALERESEQRLE-----LLMRP---ALPGATVTTFGGLKRQKVLNTQLQVQDLGIRRKKLEET 291

  Fly   296 TPSVVSAPAETKATNQPAAAPAGLSLLAAYSDSSEDSN 333
            |.|         |||:..     :||:..||.|..|||
  Fly   292 TSS---------ATNEKP-----ISLVGDYSSSDNDSN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 48/175 (27%)
DUF572 8..>177 CDD:282371 49/181 (27%)
CG15084NP_611383.1 COG5134 8..253 CDD:227463 62/275 (23%)
DUF572 8..239 CDD:282371 61/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12111
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2441
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.