DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and cwf16

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001342912.1 Gene:cwf16 / 3361543 PomBaseID:SPAC9.13c Length:270 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:110/262 - (41%)
Similarity:150/262 - (57%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAK-----NRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARK 60
            ||||||||||.|||:|||..|..|..|     ..:.|||||.||:|||.||||||||||||||||
pombe     1 MSERKVLNKYIPPDYDPSIRPPKKKKKFQGPNGGKLTVRLMTPFSMRCHTCGEYIYKGKKFNARK 65

  Fly    61 EDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMAL--KLAEEQARREEQ 123
            |.. .|.|..|.|.||||:||||..||:|.|||::.||..|:||:||:...  |..:|....|..
pombe    66 EKT-GEKYFSIDILRFYIRCTRCAAEITFITDPKHADYAAESGASRNYEPWHEKRLQEYEENELA 129

  Fly   124 ELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTV---DYNTLLQQ--YNTVETER 183
            |..|....:.|:.||.:|..::.:::..::|:|||:.:.|:..|   |...||::  |.::|.|.
pombe   130 ERNDIPEEDEMEKLEQKTLDTKRQMQISDALDELREKSARRSRVNIDDAIALLKEDAYGSIEEEE 194

  Fly   184 ERQER-EEREDEDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLD----------TPSAPPPAKQ 237
            .::.: ||.|.:...||:......|...|:.||..:|:...:|:|          .|:..|| |.
pombe   195 SKKRKFEEEEIDREAKSLFSSQDGEIIRRLNAETTVEKELPKPIDLVSEKLATSNIPNFQPP-KY 258

  Fly   238 AK 239
            ||
pombe   259 AK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 81/172 (47%)
DUF572 8..>177 CDD:282371 82/180 (46%)
cwf16NP_001342912.1 DUF572 8..250 CDD:309584 97/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 159 1.000 Domainoid score I1002
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I1169
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002595
OrthoInspector 1 1.000 - - oto102070
orthoMCL 1 0.900 - - OOG6_102870
Panther 1 1.100 - - LDO PTHR12111
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2441
SonicParanoid 1 1.000 - - X1951
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.