DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and RGD1560857

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_038950951.1 Gene:RGD1560857 / 317036 RGDID:1560857 Length:313 Species:Rattus norvegicus


Alignment Length:337 Identity:165/337 - (48%)
Similarity:217/337 - (64%) Gaps:29/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
  Rat     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.|::.:|.::|..|||.
  Rat    66 EAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEQEEKRMQKEREDEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQY--NTVETERERQEREERED 193
            |||||:|||.|:.|:.|:|.:|:|:||:|||:||..||:..:|.|:  :..:.:::::|.:|||.
  Rat   131 NNPMKVLENCTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLLQHRLSQEQWQQQQEEEDERET 195

  Fly   194 EDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSKASAAQS 258
            ...::...::            .::::...|....||.|..|.:..|:.| |.....:|.. |:.
  Rat   196 VALLEEARYR------------RLLDDSDSEDEAPPSRPQAAARPNPTAI-LDEVPKTKRK-AEG 246

  Fly   259 MVKRKTPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQPAAAP--AGLSL 321
            :.::.....||.||.   ||.....|:.||.   ..||    .||...|..|.....|  :.||.
  Rat   247 LCRKAQLAGLVIPKK---AKTEANRGSEQVR---VPTT----GAPESRKVANPAPQTPGASSLSQ 301

  Fly   322 LAAYSDSSEDSN 333
            |.||.| ||||:
  Rat   302 LCAYGD-SEDSD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 117/162 (72%)
DUF572 8..>177 CDD:282371 118/170 (69%)
RGD1560857XP_038950951.1 DUF572 9..310 CDD:398281 154/325 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1638
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6350
Inparanoid 1 1.050 294 1.000 Inparanoid score I2673
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002595
OrthoInspector 1 1.000 - - otm46350
orthoMCL 1 0.900 - - OOG6_102870
Panther 1 1.100 - - O PTHR12111
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.