DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and TRIL

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_055632.2 Gene:TRIL / 9865 HGNCID:22200 Length:811 Species:Homo sapiens


Alignment Length:964 Identity:229/964 - (23%)
Similarity:354/964 - (36%) Gaps:268/964 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 CPKDCKC---LNVLFDCDKLHLERVP---VLPS--YVQTLHLANNKLNDTTVLEIRNLLNLTKVS 321
            ||:.|.|   .::|  |....|..||   .|||  .|.|..|..|.:.:.|..:...|..|.::.
Human    27 CPERCDCQHPQHLL--CTNRGLRVVPKTSSLPSPHDVLTYSLGGNFITNITAFDFHRLGQLRRLD 89

  Fly   322 LKRNLLEVI-PK-FIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKS 384
            |:.|.:..: || |..||.|:.|.|.||.:.:::..:||.|..||.|..:.|::..:...||...
Human    90 LQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPGTLAPLRKLRILYANGNEISRLSRGSFEGL 154

  Fly   385 NNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINW 449
            .:||.|.|..|.:..:.:..||.|.||..|.|.:||:..|....|..|.:|:.|.|:.|:|:.:.
Human   155 ESLVKLRLDGNALGALPDAVFAPLGNLLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSL 219

  Fly   450 ---STFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNL 511
               :||..|.|:.:|.|.:|.::.|...:|..:.::..:.|..||::.|:.:..:.|..||.|.|
Human   220 RHAATFAPLRSLSSLILSANNLQHLGPRIFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALRELRL 284

  Fly   512 SFNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVK 576
            ..|.:|::.....|...|||.||||.|.::...|.                        ||..:.
Human   285 EGNRLSQLPTALLEPLHSLEALDLSGNELSALHPA------------------------TFGHLG 325

  Fly   577 NLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNAL 641
            .|.||:||.|.||.:..|..||:|     .|.||||.||                          
Human   326 RLRELSLRNNALSALSGDIFAASP-----ALYRLDLDGN-------------------------- 359

  Fly   642 ASIQVNAFEHMLRLNKLVFKSLNFICDCDLVWFQQWLKNRFPQQAEHAV---CGYPEHLLDRHLK 703
                                  .:.|||.|...::|:.:...|.....|   |.:|..|..::|.
Human   360 ----------------------GWTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLD 402

  Fly   704 SLSSSEL---VCVDSPKPRVEQEPDDMLAVNAANITLECIASS-PTAAS------LAAADELKIK 758
            .|...:|   .|.| |.|             :|::|.:..... ||||.      ...|:||..:
Human   403 YLDDQQLQNGSCAD-PSP-------------SASLTADRRRQPLPTAAGEEMTPPAGLAEELPPQ 453

  Fly   759 WRHDNQHVQERPAVHDGASTETQIRHDLSTNQTSIYGYLRLTNVTYESAGRYQCVVSNAFGTTYA 823
            .:...|.........|||:.|      |..|:::    |||:.   ...|..|...|.|.....|
Human   454 PQLQQQGRFLAGVAWDGAARE------LVGNRSA----LRLSR---RGPGLQQPSPSVAAAAGPA 505

  Fly   824 QKFKISIGIHPTFLQVPSNLTLDAGEMARLVCSASGDPTPEIALQKFGGSEFPA------ATERR 882
            .:   |:.:|    :.|..     |...| ...|..:|||..:.   |.:..||      ||:.|
Human   506 PQ---SLDLH----KKPQR-----GRPTR-ADPALAEPTPTASP---GSAPSPAGDPWQRATKHR 554

  Fly   883 LQVIREENAFLITNAKPSDSGIYTCTALSAAGEIKVNATLVVNDKPQPSIPLVHQEVVVGRTCVL 947
            |....:|      .|..||.|         ||              .|  |||.......:..:.
Human   555 LGTEHQE------RAAQSDGG---------AG--------------LP--PLVSDPCDFNKFILC 588

  Fly   948 QCLSETANAD-FELEHPHREWFKENKPIHISPTAPDGDRY------YFSNNKELLVILNAQSNDA 1005
            ....|...|| ..:....||        |.||....|.|:      :....|....:...:|:|:
Human   589 NLTVEAVGADSASVRWAVRE--------HRSPRPLGGARFRLLFDRFGQQPKFHRFVYLPESSDS 645

  Fly  1006 GHFR--------------------CEITDNSRTFTLQSELVVVKE-----NLNWVVLLVGIITVT 1045
            ...|                    |.:......    :.||.:.|     .:::.:|.:.::||.
Human   646 ATLRELRGDTPYLVCVEGVLGGRVCPVAPRDHC----AGLVTLPEAGSRGGVDYQLLTLALLTVN 706

  Fly  1046 VICVVVDCCIIWCTLRYQKKKLRMSLAAER-----------HSTQLRPRSLADLGCSYDEA---N 1096
            .:.|:: ....|.: |:.::|||    |.|           :||: ||......|.|.|.:   :
Human   707 ALLVLL-ALAAWAS-RWLRRKLR----ARRKGGAPVHVRHMYSTR-RPLRSMGTGVSADFSGFQS 764

  Fly  1097 HRRLTVMSTPPSEQRCLEQGLTLSYLRQTDL-EAQQDHLSSKDSGTGSDAAVKR 1149
            ||..|                |:..|.:.|| |...|.... .:|.|:..:::|
Human   765 HRPRT----------------TVCALSEADLIEFPCDRFMD-SAGGGAGGSLRR 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 101/353 (29%)
leucine-rich repeat 293..316 CDD:275380 6/22 (27%)
leucine-rich repeat 317..338 CDD:275380 7/22 (32%)
leucine-rich repeat 339..362 CDD:275380 8/22 (36%)
leucine-rich repeat 363..386 CDD:275380 6/22 (27%)
leucine-rich repeat 387..410 CDD:275380 8/22 (36%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 8/24 (33%)
leucine-rich repeat 458..481 CDD:275380 5/22 (23%)
leucine-rich repeat 482..505 CDD:275380 5/22 (23%)
leucine-rich repeat 506..529 CDD:275380 7/22 (32%)
leucine-rich repeat 530..553 CDD:275380 8/22 (36%)
leucine-rich repeat 554..577 CDD:275380 2/22 (9%)
leucine-rich repeat 578..604 CDD:275380 12/25 (48%)
leucine-rich repeat 607..630 CDD:275380 7/22 (32%)
leucine-rich repeat 631..652 CDD:275380 0/20 (0%)
LRRCT 665..712 CDD:214507 13/52 (25%)
Ig_3 717..816 CDD:464046 22/105 (21%)
Ig 835..924 CDD:472250 21/94 (22%)
Ig strand B 851..855 CDD:409353 1/3 (33%)
Ig strand C 864..868 CDD:409353 0/3 (0%)
Ig strand E 890..894 CDD:409353 0/3 (0%)
Ig strand F 904..909 CDD:409353 0/4 (0%)
Ig strand G 917..920 CDD:409353 0/2 (0%)
Ig_3 927..1013 CDD:464046 19/112 (17%)
TRILNP_055632.2 leucine-rich repeat 37..61 CDD:275380 8/25 (32%)
LRR 61..>344 CDD:443914 90/306 (29%)
LRR 1 61..81 5/19 (26%)
leucine-rich repeat 62..84 CDD:275380 5/21 (24%)
LRR 2 84..105 6/20 (30%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
LRR 3 108..129 6/20 (30%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR 4 132..153 6/20 (30%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
LRR 5 156..177 6/20 (30%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
LRR 6 180..201 8/20 (40%)
leucine-rich repeat 181..204 CDD:275380 8/22 (36%)
LRR 7 204..223 5/18 (28%)
leucine-rich repeat 205..254 CDD:275380 14/48 (29%)
LRR 8 230..251 6/20 (30%)
LRR 9 254..275 4/20 (20%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
LRR 10 278..299 6/20 (30%)
leucine-rich repeat 279..302 CDD:275380 7/22 (32%)
LRR 11 302..323 11/44 (25%)
leucine-rich repeat 303..326 CDD:275380 10/46 (22%)
LRR 12 326..347 9/20 (45%)
leucine-rich repeat 327..346 CDD:275380 9/18 (50%)
PCC 332..>401 CDD:188093 26/121 (21%)
leucine-rich repeat 351..363 CDD:275378 7/59 (12%)
PHA03378 <478..>579 CDD:223065 36/154 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..549 18/83 (22%)
FN3 589..667 CDD:473895 14/85 (16%)

Return to query results.
Submit another query.