DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and LRIG2

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_055628.1 Gene:LRIG2 / 9860 HGNCID:20889 Length:1065 Species:Homo sapiens


Alignment Length:996 Identity:315/996 - (31%)
Similarity:505/996 - (50%) Gaps:121/996 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 AQKALEAAAAAAKASNKYNIDCPKDCKCLNVLFDCDKLHLERVP---------VLPSYVQTLHLA 299
            ||.||....||....      ||..|.|...|.||.:   .::|         :||.....|..:
Human    28 AQTALLLLPAAGAGL------CPAPCSCRIPLLDCSR---RKLPAPSWRALSGLLPPDTAILDFS 83

  Fly   300 NNKLNDTTV-LEIRNLLNLTKVSLKRNLLEVIPKFIG--LSGLKHLVLANNHITSISSESLAALP 361
            :|:|::..: ||.:   .|.:|.:..|.|..||.| |  .|.:..|.|.:|.|..|::::|...|
Human    84 HNRLSNWNISLESQ---TLQEVKMNYNELTEIPYF-GEPTSNITLLSLVHNIIPEINAQALQFYP 144

  Fly   362 LLRTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATL-NNLTDLELSNNRLSTLP 425
            .|.:||||.|.:..|:.:|||:. .|.:|.||.|.||.:....|..| ::|..::|:.||:|.:|
Human   145 ALESLDLSSNIISEIKTSSFPRM-QLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRMSMIP 208

  Fly   426 IRVFKNLNQLKKLALNFNQLEI-NWSTFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAM 489
            .::|| |..|:.|.|..|:::| ...||:||:|:::|:::.|.|..|:||.|:.::.:|.::|..
Human   209 PKIFK-LPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEH 272

  Fly   490 NQISSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRL 554
            |.::.:::..|:.|..|:.|.:|.|||.||..|.|||.|.|..||||.|.:..........|..|
Human   273 NNLTRVNKGWLYGLRMLQQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLL 337

  Fly   555 KTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQ 619
            :.|||..||:.::.:..|..:.||:.|:||.|.:||.|||.|.|  |.||..|.:|.|.||.:|.
Human   338 ERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNEISWAIEDASEA--FAGLTSLTKLILQGNQIKS 400

  Fly   620 ISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLNFICDCDLVWFQQWLKNRFPQ 684
            |:.||..||.:||.|:|.:||:.|||.|||. ...|.:|:..:.:.:|||.|.|..|||.:...|
Human   401 ITKKAFIGLESLEHLDLNNNAIMSIQENAFS-QTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQ 464

  Fly   685 QAEHAVCGYPEHLLDRHLKSLSSSELVCVDSPKPRVEQEPDDMLAVNAANITLECIASSPTAASL 749
            .:.:..|.:||.|..:.:.::...:.||.|..||::...|:.::|:...|:||.|.|.|.:.:.:
Human   465 HSVNVSCAHPEWLAGQSILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPM 529

  Fly   750 AAADELKIKWRHDNQHVQERPAVHDGASTETQIRHDLSTNQTSIY-GYLRLTNVTYESAGRYQCV 813
            :..      ||.|::.:.:       ..||..:|:.....:...| ..|.|.||.:...|:|||:
Human   530 STV------WRKDSEILYD-------VDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCI 581

  Fly   814 VSNAFGTTYAQKFKISIGIHPTFLQVPSNLTLDAGEMARLVCSASGDPTPEIALQKFGGSEFPAA 878
            |:|.||:.|:||.|:::...|:||:.|.:||:..|.||||.|:|.|.|.|:|:.||.||::||||
Human   582 VTNHFGSNYSQKAKLTVNEMPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAA 646

  Fly   879 TERRLQVIREENAFLITNAKPSDSGIYTCTALSAAGEIKVNATLVVNDKPQPSIPLVHQEVVVGR 943
            .|||:.|:.|::.|.|.|.|..|.|||:|.|.:.||.:..||:|.|.:.|....||..:.|..|.
Human   647 RERRMHVMPEDDVFFIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPLEDKTVTRGE 711

  Fly   944 TCVLQCLSETANADFELEHPHREWFKENKPIHISPTAPDGDRYYFSNNKELLVILNAQSNDAGHF 1008
            |.||||::..:.|      |...|.|::.|:.::      :|::|:...:||:|::|...|||.:
Human   712 TAVLQCIAGGSPA------PRLNWTKDDGPLLVT------ERHFFAAANQLLIIVDAGLEDAGKY 764

  Fly  1009 RCEITDNSRTFTLQSELVVVK-------------ENLNWVVLLVGIITVTVICVVVDCCIIWCTL 1060
            .|.:::...|......|.|:.             |:..|..  |||:.:.|:|.||...:||..:
Human   765 TCIMSNTLGTERGHIYLNVISSPNCDSSQSSIGHEDDGWTT--VGIVIIVVVCCVVGTSLIWVIV 827

  Fly  1061 RYQKKKL----------RMSLAAE------RHSTQLRPRSLADLGCSYDEA-NHRRLTVMSTPPS 1108
            .|..::.          .::|.|:      ...|...|:.    |.|..|| :|::|    .||:
Human   828 IYHMRRKNEDYSITNTEELNLPADIPSYLSSQGTLSEPQE----GYSNSEAGSHQQL----MPPA 884

  Fly  1109 EQRCLEQGLTLSYLRQTDLEAQQDHLSSKDSGTGSDAAVKRTLDDFEVAMPSHKH--HTDDEEEE 1171
            .          .|:.:           ..|.|||:........|:..:...:.::  :|...||:
Human   885 N----------GYIHK-----------GTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEED 928

  Fly  1172 EVEEVYEENEPPYIKHTYEVN 1192
            .:::..........|.||.|:
Human   929 VLDQTLSSLMVQMPKETYLVH 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 131/353 (37%)
leucine-rich repeat 293..316 CDD:275380 5/23 (22%)
leucine-rich repeat 317..338 CDD:275380 8/22 (36%)
leucine-rich repeat 339..362 CDD:275380 6/22 (27%)
leucine-rich repeat 363..386 CDD:275380 10/22 (45%)
leucine-rich repeat 387..410 CDD:275380 9/23 (39%)
leucine-rich repeat 411..434 CDD:275380 9/22 (41%)
leucine-rich repeat 435..457 CDD:275380 9/22 (41%)
leucine-rich repeat 458..481 CDD:275380 7/22 (32%)
leucine-rich repeat 482..505 CDD:275380 5/22 (23%)
leucine-rich repeat 506..529 CDD:275380 12/22 (55%)
leucine-rich repeat 530..553 CDD:275380 7/22 (32%)
leucine-rich repeat 554..577 CDD:275380 7/22 (32%)
leucine-rich repeat 578..604 CDD:275380 13/25 (52%)
leucine-rich repeat 607..630 CDD:275380 11/22 (50%)
leucine-rich repeat 631..652 CDD:275380 12/20 (60%)
LRRCT 665..712 CDD:214507 13/46 (28%)
Ig_3 717..816 CDD:464046 26/99 (26%)
Ig 835..924 CDD:472250 44/88 (50%)
Ig strand B 851..855 CDD:409353 3/3 (100%)
Ig strand C 864..868 CDD:409353 1/3 (33%)
Ig strand E 890..894 CDD:409353 1/3 (33%)
Ig strand F 904..909 CDD:409353 3/4 (75%)
Ig strand G 917..920 CDD:409353 0/2 (0%)
Ig_3 927..1013 CDD:464046 25/85 (29%)
LRIG2NP_055628.1 RNA1 <54..184 CDD:444072 43/137 (31%)
LRR 1 76..97 5/20 (25%)
LRR 2 98..119 8/21 (38%)
leucine-rich repeat 99..121 CDD:275378 8/22 (36%)
LRR 121..552 CDD:443914 157/448 (35%)
LRR 3 121..142 6/20 (30%)
leucine-rich repeat 122..145 CDD:275378 6/22 (27%)
LRR 4 145..166 9/20 (45%)
leucine-rich repeat 146..168 CDD:275380 10/22 (45%)
LRR 5 168..189 8/20 (40%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
LRR 6 193..214 8/21 (38%)
leucine-rich repeat 194..216 CDD:275380 9/22 (41%)
LRR 7 216..237 7/20 (35%)
leucine-rich repeat 217..240 CDD:275380 9/22 (41%)
LRR 8 240..261 8/20 (40%)
leucine-rich repeat 241..264 CDD:275380 7/22 (32%)
LRR 9 264..285 4/20 (20%)
leucine-rich repeat 265..288 CDD:275380 5/22 (23%)
LRR 10 288..309 10/20 (50%)
leucine-rich repeat 289..312 CDD:275380 12/22 (55%)
LRR 11 312..333 6/20 (30%)
leucine-rich repeat 313..336 CDD:275380 7/22 (32%)
LRR 12 336..357 7/20 (35%)
leucine-rich repeat 337..360 CDD:275380 7/22 (32%)
LRR 13 360..382 13/23 (57%)
leucine-rich repeat 361..385 CDD:275380 13/25 (52%)
LRR 14 387..408 9/20 (45%)
leucine-rich repeat 388..411 CDD:275380 11/22 (50%)
LRR 15 411..432 12/21 (57%)
leucine-rich repeat 412..434 CDD:275380 12/22 (55%)
Ig 509..598 CDD:472250 30/101 (30%)
Ig strand B 515..519 CDD:409353 2/3 (67%)
Ig strand C 530..534 CDD:409353 0/9 (0%)
Ig strand E 563..567 CDD:409353 1/3 (33%)
Ig strand F 577..582 CDD:409353 3/4 (75%)
Ig strand G 589..594 CDD:409353 2/4 (50%)
IgI_LRIG1-like 603..693 CDD:409420 44/89 (49%)
Ig strand A 603..606 CDD:409420 1/2 (50%)
Ig strand A' 610..614 CDD:409420 2/3 (67%)
Ig strand B 617..626 CDD:409420 5/8 (63%)
Ig strand C 632..637 CDD:409420 1/4 (25%)
Ig strand C' 640..642 CDD:409420 1/1 (100%)
Ig strand D 650..654 CDD:409420 1/3 (33%)
Ig strand E 658..665 CDD:409420 2/6 (33%)
Ig strand F 671..679 CDD:409420 5/7 (71%)
Ig strand G 682..693 CDD:409420 4/10 (40%)
I-set 696..783 CDD:400151 27/98 (28%)
Ig strand B 713..717 CDD:409353 2/3 (67%)
Ig strand C 726..730 CDD:409353 0/3 (0%)
Ig strand E 749..753 CDD:409353 2/3 (67%)
Ig strand F 763..768 CDD:409353 1/4 (25%)
Ig strand G 776..779 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 963..990
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1003..1040
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.