DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and lrrc3ca

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_005156157.1 Gene:lrrc3ca / 571711 ZFINID:ZDB-GENE-080327-9 Length:266 Species:Danio rerio


Alignment Length:287 Identity:63/287 - (21%)
Similarity:91/287 - (31%) Gaps:120/287 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 CPKDCKCLNV--LFD-----CDKLHLERVPV-LPSYVQTLHLANNKLNDTTVLEIRNLLNLTKVS 321
            |.|.|.|.:.  .||     |..|||..:|. :|             |||               
Zfish    36 CSKGCYCSDSEGSFDGKTMRCSNLHLTEIPQDIP-------------NDT--------------- 72

  Fly   322 LKRNLLEVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSF-PKSN 385
                              :.|.|..|.:|||.:.:...||||..||||.|:|..:|..:| ..:.
Zfish    73 ------------------RRLYLDYNLLTSIPANAFHDLPLLAELDLSHNELSLLEPGAFRGLTA 119

  Fly   386 NLVHLILSFNEITNVNEHSFATL---NNLTD--------LELSNNRLSTLPIR------------ 427
            :|..|.||.|::..::..:|.::   :|||.        |:.:..||...|:.            
Zfish   120 SLKFLDLSSNQLKTLDPDAFDSVRARSNLTGNPWHCDCRLQTALPRLDLEPVSLTGIVCQTFEPS 184

  Fly   428 -------------------VFKNLNQLKKLALNFNQLEINWSTFRGLESMKNLQLKSNKIRALQD 473
                               |.|....:..|...|     .|.|.                 .:..
Zfish   185 DAGAQGVPFLLAKDLDLCVVLKKTTDVAMLVTMF-----GWFTM-----------------VISY 227

  Fly   474 GVFYVMHKIETIDLAMNQISSL-SRQG 499
            .|:||.|..|.....:..:.|| ||||
Zfish   228 LVYYVRHNQEDARRHLEYLKSLPSRQG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 51/251 (20%)
leucine-rich repeat 293..316 CDD:275380 3/22 (14%)
leucine-rich repeat 317..338 CDD:275380 0/20 (0%)
leucine-rich repeat 339..362 CDD:275380 7/22 (32%)
leucine-rich repeat 363..386 CDD:275380 9/23 (39%)
leucine-rich repeat 387..410 CDD:275380 6/25 (24%)
leucine-rich repeat 411..434 CDD:275380 8/61 (13%)
leucine-rich repeat 435..457 CDD:275380 4/21 (19%)
leucine-rich repeat 458..481 CDD:275380 3/22 (14%)
leucine-rich repeat 482..505 CDD:275380 7/19 (37%)
leucine-rich repeat 506..529 CDD:275380
leucine-rich repeat 530..553 CDD:275380
leucine-rich repeat 554..577 CDD:275380
leucine-rich repeat 578..604 CDD:275380
leucine-rich repeat 607..630 CDD:275380
leucine-rich repeat 631..652 CDD:275380
LRRCT 665..712 CDD:214507
Ig_3 717..816 CDD:464046
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
lrrc3caXP_005156157.1 leucine-rich repeat 52..71 CDD:275378 6/31 (19%)
PRK15370 <53..>176 CDD:185268 40/168 (24%)
leucine-rich repeat 72..95 CDD:275378 8/55 (15%)
LRR_8 73..131 CDD:404697 23/57 (40%)
leucine-rich repeat 96..120 CDD:275378 9/23 (39%)
leucine-rich repeat 121..144 CDD:275378 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.