DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and LOC5666870

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_061507546.1 Gene:LOC5666870 / 5666870 VectorBaseID:AGAMI1_003343 Length:465 Species:Anopheles gambiae


Alignment Length:371 Identity:89/371 - (23%)
Similarity:161/371 - (43%) Gaps:91/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ANNHITSIS---------SESLAALPLLRTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNV 400
            :|.||.|:.         .::|..:..::.|.:.:.||..:.|:.|..:..|..|.||:|:|..:
Mosquito   147 SNTHIESLEISQCLLDRMPQTLPKMTKMKNLSIRQCKLTVVRLDMFADNQILKILDLSYNQIRQL 211

  Fly   401 ---NEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINWSTFRGLESMKNL- 461
               .|.. |.:.::..|.||.|.|..|.:..||:::||.||.:..| |.::.:....: :|||| 
Mosquito   212 LPATERP-ARMLSIETLVLSGNLLQHLDMTDFKSMSQLLKLHVGGN-LIVSLNALLPI-TMKNLI 273

  Fly   462 --QLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLT--KLRHLNLSFNAISRIEVD 522
              .|::|||.||.                           |.|||  ||..|.|..||::|:   
Mosquito   274 DFWLEANKITALD---------------------------LRNLTLPKLESLGLDGNALTRL--- 308

  Fly   523 TWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNR 587
                               .|.|:.|.   :|.:|:|..|.|..|..:.|....||.::::..|:
Mosquito   309 -------------------PFLPRSLP---KLNSLSLMSNNLTQLDLSYFRPYPNLNKIDISYNQ 351

  Fly   588 LSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLN--NLEILNLGSNALASIQVNAFE 650
            ::.:    ..::|.:  ..:..|||..|   ||:|..::|.:  |:.:|.||.|.| ::....:|
Mosquito   352 ITSV----RTSSPVR--LSVSTLDLRYN---QITTFNLTGCDTPNITLLLLGQNRL-TVFPPVYE 406

  Fly   651 HMLRLNKLVFKSLNFI-CDCDLVWFQQWLKN---RFPQQAEHAVCG 692
            ....:...:  :.||: || .|:::::.::.   ....:.:...||
Mosquito   407 KYPNIRLSI--NWNFLFCD-TLLYYKEKIQKYDLMVEPEPDSPTCG 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 80/315 (25%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380 5/25 (20%)
leucine-rich repeat 363..386 CDD:275380 5/22 (23%)
leucine-rich repeat 387..410 CDD:275380 8/25 (32%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 5/21 (24%)
leucine-rich repeat 458..481 CDD:275380 10/25 (40%)
leucine-rich repeat 482..505 CDD:275380 4/24 (17%)
leucine-rich repeat 506..529 CDD:275380 6/22 (27%)
leucine-rich repeat 530..553 CDD:275380 3/22 (14%)
leucine-rich repeat 554..577 CDD:275380 7/22 (32%)
leucine-rich repeat 578..604 CDD:275380 3/25 (12%)
leucine-rich repeat 607..630 CDD:275380 8/24 (33%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 6/32 (19%)
Ig_3 717..816 CDD:464046
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
LOC5666870XP_061507546.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.