DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Lingo4

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001102659.1 Gene:Lingo4 / 499668 RGDID:1562025 Length:618 Species:Rattus norvegicus


Alignment Length:528 Identity:127/528 - (24%)
Similarity:207/528 - (39%) Gaps:82/528 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 LPL-LRTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLST 423
            ||| ...||||.|:|..::.....:...|..|.||:|:::.:...:|..|.:|..|.|..|||..
  Rat    83 LPLDTEVLDLSGNRLWGLQRGMLSRLGQLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRI 147

  Fly   424 LPIRVFKNLNQLKKLALNFNQLEINW-STFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDL 487
            :...:|..|:.|..|.|..||:.:.. ..|..|.|::.|::..|.:..:..|.|..:.|:.||.|
  Rat   148 VGPGIFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQQLEVGDNHLVFVAPGAFSGLAKLSTITL 212

  Fly   488 AMNQISSLSRQGLFNL-----TKLRHLNL---------SFNAISRIEVDTWEFTQSLEVLDLSNN 538
            ....:|::....|..|     .:||.|::         ....:..:|:..|   .|||.||    
  Rat   213 ERCNLSTVPGLALAQLPALVALRLRELDIERLPSGALRGLGQLKELEIHHW---PSLEALD---- 270

  Fly   539 AINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAPFKG 603
                  |..|..|: |.:|.:.|..|..:.......:..|:.|:|.:|.:|.|     .|.....
  Rat   271 ------PGSLVGLN-LSSLAITHCNLSSVPFQALHHLSFLQVLDLSQNPISAI-----PARRLSP 323

  Fly   604 LRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLNFICD 668
            |.:|:.|.|.|..|..|:..|..||....:|::..|||.:::..||....:|..|........||
  Rat   324 LVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCD 388

  Fly   669 CDLVWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSLSS----SELVCVDSPKPRV--EQEPDDM 727
            |.|:|..: |:.|.........|..|:|:..::|:..|.    ....|    ||.:  :..|..:
  Rat   389 CRLLWLLR-LRRRLDFGTSPPACAGPQHVQGKNLREFSDILPPGHFTC----KPALIRKSGPRWV 448

  Fly   728 LAVNAANITLECIASSPTAASLAAADELKIKWRHDNQHVQERP-AVHDGASTETQIRHDLSTNQT 791
            :|....:....|......|.:        :.|.        || ....|.....::..|      
  Rat   449 IAEEGGHAVFSCSGDGDPAPT--------VSWM--------RPQGSWLGRVGRVRVLED------ 491

  Fly   792 SIYGYLRLTNVTYESAGRYQCVVSNAFGTTYAQKFKISIGIHP----------TFLQVPSNLTLD 846
               |.|.:.:|.....|.|.|||||..|....:.:...|.:.|          |...:|...:||
  Rat   492 ---GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNVTMPGIPGPFSLD 553

  Fly   847 AGEMARLV 854
            :..:|.::
  Rat   554 SRGVAMVL 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 80/297 (27%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380 1/1 (100%)
leucine-rich repeat 363..386 CDD:275380 6/22 (27%)
leucine-rich repeat 387..410 CDD:275380 7/22 (32%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 7/22 (32%)
leucine-rich repeat 458..481 CDD:275380 4/22 (18%)
leucine-rich repeat 482..505 CDD:275380 6/27 (22%)
leucine-rich repeat 506..529 CDD:275380 5/31 (16%)
leucine-rich repeat 530..553 CDD:275380 7/22 (32%)
leucine-rich repeat 554..577 CDD:275380 4/22 (18%)
leucine-rich repeat 578..604 CDD:275380 7/25 (28%)
leucine-rich repeat 607..630 CDD:275380 9/22 (41%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 12/50 (24%)
Ig_3 717..816 CDD:464046 19/101 (19%)
Ig 835..924 CDD:472250 5/20 (25%)
Ig strand B 851..855 CDD:409353 1/4 (25%)
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
Lingo4NP_001102659.1 leucine-rich repeat 87..110 CDD:275380 6/22 (27%)
LRR <88..441 CDD:443914 97/376 (26%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
leucine-rich repeat 135..158 CDD:275380 8/22 (36%)
leucine-rich repeat 159..182 CDD:275380 7/22 (32%)
leucine-rich repeat 183..206 CDD:275380 4/22 (18%)
leucine-rich repeat 207..230 CDD:275380 6/22 (27%)
leucine-rich repeat 231..254 CDD:275380 3/22 (14%)
leucine-rich repeat 255..302 CDD:275380 14/60 (23%)
leucine-rich repeat 303..326 CDD:275380 8/27 (30%)
leucine-rich repeat 327..348 CDD:275380 7/20 (35%)
leucine-rich repeat 351..374 CDD:275380 6/22 (27%)
IG_like 445..526 CDD:214653 20/105 (19%)
Ig strand B 456..460 CDD:409353 0/3 (0%)
Ig strand C 469..473 CDD:409353 0/11 (0%)
Ig strand E 492..496 CDD:409353 2/3 (67%)
Ig strand F 506..511 CDD:409353 2/4 (50%)
Ig strand G 519..522 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.