DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and lingo1b

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001004576.1 Gene:lingo1b / 447837 ZFINID:ZDB-GENE-040912-136 Length:622 Species:Danio rerio


Alignment Length:807 Identity:161/807 - (19%)
Similarity:268/807 - (33%) Gaps:280/807 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 CPKDCKC----LNVLFDCDKLHLERVPV-LPSYVQTLHLANNKLNDTTVLEIRNLLNLTKVSLKR 324
            ||..|:|    .:|:  |.:..|..:|. :|...:.|.|:.|:|......|..|...|..:.|..
Zfish    44 CPSRCECSAQERSVV--CHRRKLITLPEGIPIDTRLLDLSKNRLKAINPEEFLNYPQLEDLQLNE 106

  Fly   325 NLLEVIP--KFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNNL 387
            |::.||.  .|..|.|                        ||||.|..|.|..|:|..|...:||
Zfish   107 NIISVIEPGAFSNLLG------------------------LRTLGLRNNNLKLIQLGVFTGLSNL 147

  Fly   388 VHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLAL-NFNQLEINWST 451
            ..|.:|.|:|..:.::.|..|.||.:||:.:|.|..:..|.|..|:.|::|.: ..|...:....
Zfish   148 TRLDISENKIVILLDYMFQELYNLKELEVGDNDLVFISHRAFHGLSSLEQLTMERCNLTSVPTEA 212

  Fly   452 FRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLA----MNQISSLSRQGLFNLTKLRHLNLS 512
            |..|.::..|:|:...:..::|..|..:::::.:::|    :..:::.|..|| |:|.|...|.:
Zfish   213 FSHLHNLLTLKLRHLNVNVIRDFSFRRLYRLKILEIANWPLLESLTAKSLHGL-NITTLSITNCN 276

  Fly   513 FNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKN 577
            ..|:..:.:                        ||   |..|:..||:.|.::.::.|       
Zfish   277 LTAVPYVAI------------------------QH---LVYLRFFNLSFNPIEVVEGN------- 307

  Fly   578 LEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALA 642
                                  ....|.:|:...|.|..|..|...:..|||.|.:||:.||:|:
Zfish   308 ----------------------KMHNLLRLQAFHLVGGRLVSIEPYSFKGLNYLRVLNVSSNSLS 350

  Fly   643 SIQVNAFEHMLRLNKLVFKSLNFICDCDLVWF--QQWLKNRFPQQAEHAVCGYPEHLLDRHLKSL 705
            :::.:||..:..|..|........|||.|:|.  ::|..|...||..   |..||.|..:..|  
Zfish   351 TLEESAFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQPS---CETPEFLQGKEFK-- 410

  Fly   706 SSSELVCVDSPKPRVEQEPDDMLAVNAANITLECIASSPTAASLAAADELKIKWRHDNQHVQERP 770
                    |.|         |:|..|    ...|..|.                      :::..
Zfish   411 --------DFP---------DVLPPN----YFTCQKSK----------------------IRDHK 432

  Fly   771 AVHDGASTETQIRHDLSTNQTSIYGYLRLTNVTYESAGRYQCVVSNAFGTTYAQKFKISIGIHPT 835
            |:|                                                   :|         
Zfish   433 AIH---------------------------------------------------RF--------- 437

  Fly   836 FLQVPSNLTLDAGEMARLVCSASGDPTPEIALQKFGGSEFPAATERRLQVIREENAFLITNAKPS 900
                     :|.|...:..|.|.|||||.|..|..........:..||.| ..:....:..|:..
Zfish   438 ---------VDEGTTVQFPCQADGDPTPMIMWQSPKKQFITTKSIGRLSV-SLDGTLEVRYAQIQ 492

  Fly   901 DSGIYTCTALSAAGEIKVNATLVVNDKPQPSIPLVHQEVVVGRTCVLQCLSETANADFELEHPHR 965
            |:|.|||.|::|.|.                                         |..|.|.|.
Zfish   493 DNGTYTCFAVNAGGN-----------------------------------------DTRLAHLHV 516

  Fly   966 EWFKENKPIHISPTAPDGDRYYFSNNKELLVILNAQSNDAGHFRCEITDNSRTFTLQSELVVVKE 1030
            ..:..|.|              ...||....|||..|:::.:.    |.....|....:.:::..
Zfish   517 HSYSPNWP--------------HQPNKTFAFILNQPSDNSANG----TGAMDPFPFDMKTLIIAT 563

  Fly  1031 NLNWVVLLVGIITVTVICVVVDCCIIW 1057
            .:.::..| |::   :.|:|:  ..:|
Zfish   564 TMGFISFL-GVV---LFCLVL--LFLW 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 81/355 (23%)
leucine-rich repeat 293..316 CDD:275380 6/22 (27%)
leucine-rich repeat 317..338 CDD:275380 7/22 (32%)
leucine-rich repeat 339..362 CDD:275380 0/22 (0%)
leucine-rich repeat 363..386 CDD:275380 10/22 (45%)
leucine-rich repeat 387..410 CDD:275380 7/22 (32%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 5/22 (23%)
leucine-rich repeat 458..481 CDD:275380 4/22 (18%)
leucine-rich repeat 482..505 CDD:275380 5/26 (19%)
leucine-rich repeat 506..529 CDD:275380 3/22 (14%)
leucine-rich repeat 530..553 CDD:275380 3/22 (14%)
leucine-rich repeat 554..577 CDD:275380 5/22 (23%)
leucine-rich repeat 578..604 CDD:275380 0/25 (0%)
leucine-rich repeat 607..630 CDD:275380 7/22 (32%)
leucine-rich repeat 631..652 CDD:275380 8/20 (40%)
LRRCT 665..712 CDD:214507 14/48 (29%)
Ig_3 717..816 CDD:464046 7/98 (7%)
Ig 835..924 CDD:472250 23/88 (26%)
Ig strand B 851..855 CDD:409353 0/3 (0%)
Ig strand C 864..868 CDD:409353 1/3 (33%)
Ig strand E 890..894 CDD:409353 0/3 (0%)
Ig strand F 904..909 CDD:409353 3/4 (75%)
Ig strand G 917..920 CDD:409353 0/2 (0%)
Ig_3 927..1013 CDD:464046 12/85 (14%)
lingo1bNP_001004576.1 Ig strand G 509..512 CDD:409353 0/2 (0%)
LRRNT 43..77 CDD:214470 9/34 (26%)
LRR 1 74..95 5/20 (25%)
leucine-rich repeat 75..98 CDD:275380 6/22 (27%)
LRR 77..>373 CDD:443914 86/376 (23%)
LRR 2 98..119 6/20 (30%)
leucine-rich repeat 99..146 CDD:275380 18/70 (26%)
LRR 3 122..143 11/44 (25%)
LRR 4 146..167 7/20 (35%)
leucine-rich repeat 147..170 CDD:275380 7/22 (32%)
LRR 5 170..191 8/20 (40%)
leucine-rich repeat 171..194 CDD:275380 8/22 (36%)
LRR 6 194..215 4/20 (20%)
leucine-rich repeat 195..218 CDD:275380 5/22 (23%)
LRR 7 218..239 4/20 (20%)
leucine-rich repeat 219..242 CDD:275380 4/22 (18%)
leucine-rich repeat 243..290 CDD:275380 12/74 (16%)
LRR 8 266..287 5/44 (11%)
LRR 9 290..311 5/49 (10%)
leucine-rich repeat 291..338 CDD:275380 13/75 (17%)
LRR 10 314..335 5/20 (25%)
LRR 11 338..359 8/20 (40%)
leucine-rich repeat 339..362 CDD:275380 8/22 (36%)
PCC 343..>425 CDD:188093 28/107 (26%)
Ig 425..516 CDD:472250 30/223 (13%)
Ig strand B 444..448 CDD:409353 0/3 (0%)
Ig strand C 457..461 CDD:409353 1/3 (33%)
Ig strand E 482..486 CDD:409353 0/3 (0%)
Ig strand F 496..501 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.