DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and MstProx

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster


Alignment Length:605 Identity:121/605 - (20%)
Similarity:196/605 - (32%) Gaps:254/605 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 IDCPKDCKCLNVL------FDCDKLHLERVPVLPSYVQTLHLANNKLNDTTVLEIRNLLNLTKVS 321
            ::|||.|:||.::      .||..|.|.::|.||                               
  Fly   283 LECPKLCQCLYIIDDLELNIDCSNLGLLQIPPLP------------------------------- 316

  Fly   322 LKRNLLEVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNN 386
                    ||.:.|:.    |..:||.::.:.:.:|....|::.||:|||:|..:.:|..|.  .
  Fly   317 --------IPSYGGVK----LNFSNNSLSQLPTMTLPGYKLVKRLDVSRNRLTNLSINHLPA--K 367

  Fly   387 LVHLILSFNEITNVNEHSFATLNNLTDLELSNN---------------RLSTLPIRV-------- 428
            |.:|.:|||||.|:.......|..:...:.:.|               |...|.||:        
  Fly   368 LDYLDVSFNEIINMGNDVIKYLRTVPIFKQTGNQWTIHCDDKPLLNFFRHLKLIIRMKSAEMKPM 432

  Fly   429 -FKNLNQLKKLALNFNQLEINWSTFRGLE--------SMKNLQLKSNKIRALQD----------- 473
             ..:|.:|.|..|.|......|...|..|        .::::..|.|.:..:..           
  Fly   433 FLHSLTELPKGFLKFLGKHFIWLGVRKQEYYLINEEQLLQSMHRKLNNLNTIMSIYKYMEWLHRK 497

  Fly   474 --------GVFYVM-------HKIETI---------------------DLAMNQISSLSRQGLFN 502
                    .:||:.       ||.|..                     |:.......:.:|   |
  Fly   498 LIFVNREYDLFYIRQMAAPCPHKCECCYSRDSLILKIDCRNKFVYNFPDIVARNSRLMGKQ---N 559

  Fly   503 LTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLS-NNAI------------NEFK------PQHL 548
            ::....|:||.|.||.|.:..  ..:.|..|||. ||.:            |..|      |.:.
  Fly   560 MSSPMELHLSKNNISNITIAM--LPKELRFLDLRFNNLVTLDDKVLSYLKKNSIKTKLSGNPWNC 622

  Fly   549 DCLHRLKTLNLA--HNRLQYLQENTFDCVKNLEELNLRR----------------NRLSW---II 592
            ||..| ..|::.  |..|:|             ::.|:|                :.|:|   |:
  Fly   623 DCKSR-SVLSILRDHEPLEY-------------DVTLKRCNISPTDCPDVCVCCLDNLTWPSFIV 673

  Fly   593 EDQSAAAPFKGLRKLRRL-------DLHGNNLKQISTKAMSGL------------------NNLE 632
            :.:.     :||.::..|       ||..|||..:|.|..|.:                  |::|
  Fly   674 DCRG-----EGLLQMPSLSSRVTYVDLRNNNLTALSQKNRSSIENRSLKLHLLDNPWSCSCNDIE 733

  Fly   633 ILNLGSNALASIQVNAFEHMLRLN--KLVFKSLNFICDCD--------------------LVWFQ 675
            .:|...:..:||.  .|..:...|  |||..:.:.:|..|                    |:||:
  Fly   734 KINFMKSVSSSIV--DFTEIKCSNGEKLVSINQHIVCPSDLFYYLALAISLVATIIALNFLIWFR 796

  Fly   676 Q----WLKNRFPQQAEHAVC 691
            |    |.       .||.||
  Fly   797 QPVLVWF-------YEHGVC 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 90/492 (18%)
leucine-rich repeat 293..316 CDD:275380 0/22 (0%)
leucine-rich repeat 317..338 CDD:275380 3/20 (15%)
leucine-rich repeat 339..362 CDD:275380 4/22 (18%)
leucine-rich repeat 363..386 CDD:275380 8/22 (36%)
leucine-rich repeat 387..410 CDD:275380 9/22 (41%)
leucine-rich repeat 411..434 CDD:275380 6/46 (13%)
leucine-rich repeat 435..457 CDD:275380 7/29 (24%)
leucine-rich repeat 458..481 CDD:275380 4/48 (8%)
leucine-rich repeat 482..505 CDD:275380 4/43 (9%)
leucine-rich repeat 506..529 CDD:275380 7/22 (32%)
leucine-rich repeat 530..553 CDD:275380 11/41 (27%)
leucine-rich repeat 554..577 CDD:275380 4/24 (17%)
leucine-rich repeat 578..604 CDD:275380 5/44 (11%)
leucine-rich repeat 607..630 CDD:275380 9/47 (19%)
leucine-rich repeat 631..652 CDD:275380 5/20 (25%)
LRRCT 665..712 CDD:214507 11/51 (22%)
Ig_3 717..816 CDD:464046
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
MstProxNP_649719.2 PRK15370 <315..>398 CDD:185268 27/127 (21%)
leucine-rich repeat 325..345 CDD:275378 4/19 (21%)
leucine-rich repeat 346..367 CDD:275378 8/22 (36%)
TIR 823..960 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.