DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Con

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:682 Identity:155/682 - (22%)
Similarity:242/682 - (35%) Gaps:241/682 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LITYMLLITAATICQSAAQSPSSSNGNGVGGSGSTGGSPLSALLKSGGASYNQQLPQQQLFAMLT 154
            |:..:|||.|..:..:..::.......|.|.|        |.:|.|..:|.|..           
  Fly    21 LLLSLLLIGACLVTPTEGRAKDDRRTRGRGSS--------SGVLSSSSSSSNNM----------- 66

  Fly   155 RNGGGSSGPRSSGGNRGY--TSARQHFMALSEDYSDADVDEEDMAALHYPLSASHPPAGVQGSSS 217
            .||..|....::|.:.||  ||:                                       |:.
  Fly    67 NNGYYSGSSSTAGSSSGYVFTSS---------------------------------------SAV 92

  Fly   218 SSGISIQSGSLETNGFVADDGGQYEHAQKALEAAAAAAKASNKYNIDCPKDCKCLNVLFDCDKLH 282
            :||.:..||.:::.||..                         ...|....|.|..     |:.|
  Fly    93 NSGSTGYSGPMDSTGFCT-------------------------RRRDMKLMCYCTP-----DENH 127

  Fly   283 LERVPVLPS----YVQTLHLANNKLNDTTVLEIRNLLNLTKVSLKRNLLEVIPKFIGLSGLKHLV 343
               |||..:    :.:.||     .||||         .|:...::.|.|:  ||         |
  Fly   128 ---VPVQKAECWVFSEGLH-----QNDTT---------WTRFYQQKRLREL--KF---------V 164

  Fly   344 LANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATL 408
            :.||          |.|..:.|:.:...|             ||..:::.::::..|..::||.|
  Fly   165 IQNN----------ARLDYIPTMIIEPLK-------------NLSSIVIEYSQVEIVKSYAFANL 206

  Fly   409 NNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQL-EINWSTFRGLESMKNLQLKSNKIRALQ 472
            ..|..:.|:||.:..|....|.|..:|::|.|..||: |::...||.|...:.|.|.:|.|..|.
  Fly   207 PFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLH 271

  Fly   473 DGVFYVMHKIETIDLAMNQISSLSRQ-----GLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEV 532
            :|:|..|.::..::||.|||:.|:.:     |..|:.||...||:|.. ..:..:.|    ||..
  Fly   272 EGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIG-DTVFAELW----SLSE 331

  Fly   533 LDLSNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSA 597
            |:|.:|.|.....:.||.|:.||||||                         ||.|         
  Fly   332 LELDDNRIERISERALDGLNTLKTLNL-------------------------RNNL--------- 362

  Fly   598 AAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHML-----RLNK 657
                               ||:|....:.|...|..:|:.:|.|.::....|:.::     ..::
  Fly   363 -------------------LKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSE 408

  Fly   658 LVFKSLNFICDCDLVWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSLSSSE-LVC-VDSPKPR- 719
            |:.....|||||.|.|..: ||||                 .|||:...|.| |.| :..||.. 
  Fly   409 LLVSDNKFICDCRLQWIFE-LKNR-----------------TRHLQLRDSLEDLHCTLQEPKLSH 455

  Fly   720 -VEQEPDDMLAV-NAANITLECIASSPTAASL 749
             |:..|..:|.| |....|    |....:||:
  Fly   456 FVDPVPPTILDVLNIGGFT----AIGSNSASM 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 87/354 (25%)
leucine-rich repeat 293..316 CDD:275380 6/22 (27%)
leucine-rich repeat 317..338 CDD:275380 5/20 (25%)
leucine-rich repeat 339..362 CDD:275380 5/22 (23%)
leucine-rich repeat 363..386 CDD:275380 2/22 (9%)
leucine-rich repeat 387..410 CDD:275380 5/22 (23%)
leucine-rich repeat 411..434 CDD:275380 7/22 (32%)
leucine-rich repeat 435..457 CDD:275380 9/22 (41%)
leucine-rich repeat 458..481 CDD:275380 8/22 (36%)
leucine-rich repeat 482..505 CDD:275380 8/27 (30%)
leucine-rich repeat 506..529 CDD:275380 5/22 (23%)
leucine-rich repeat 530..553 CDD:275380 8/22 (36%)
leucine-rich repeat 554..577 CDD:275380 6/22 (27%)
leucine-rich repeat 578..604 CDD:275380 3/25 (12%)
leucine-rich repeat 607..630 CDD:275380 4/22 (18%)
leucine-rich repeat 631..652 CDD:275380 5/20 (25%)
LRRCT 665..712 CDD:214507 17/47 (36%)
Ig_3 717..816 CDD:464046 10/36 (28%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
ConNP_523930.3 LRR <157..459 CDD:443914 104/411 (25%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 7/27 (26%)
leucine-rich repeat 329..352 CDD:275380 8/22 (36%)
leucine-rich repeat 353..376 CDD:275380 13/75 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.