DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and CG14762

DIOPT Version :9

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:453 Identity:121/453 - (26%)
Similarity:217/453 - (47%) Gaps:71/453 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 KLNDTTVL-EIRNLLNLTK--------------VSLKRNLLEVIPKFIGLS-GLKHLVLANNHIT 350
            |.|...:| |..:|.::||              :.|:.|.|..:..|:.|: .::||.:.|:.:.
  Fly    53 KKNGLDILCETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLA 117

  Fly   351 SISSESLAALPL-LRTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATLNNLTDL 414
            :|...:|::|.. |..||:|.|::.|:...:.....:|:.|.|:.|:||.::.::|..|..|..|
  Fly   118 AIEENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEIL 182

  Fly   415 ELSNNRLSTLPIRVFKNL-NQLKKLALNFNQL-EINWSTFRGLESMKNLQLKSNKIRALQDGVFY 477
            .|..|:::.:....|:.| :.:|:|.|..|.| .|.......|.::|.|:::.||||.:.:|.|.
  Fly   183 TLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFE 247

  Fly   478 VMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWE-FTQSLEVLDLSNNAIN 541
            .:..::::.||.|.|:::......:||.|..|.|..|.||.|:.|.:: ..::|:.|.|.:|.|:
  Fly   248 GLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIH 312

  Fly   542 EFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCV-KNLEELNLRRNRLSWIIEDQSAAAPFKGLR 605
            ....:.|..||||:.|:|.:|.:..|.|:.|... .:|..|||::                    
  Fly   313 TIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQK-------------------- 357

  Fly   606 KLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHM---LRLNKLVFKSLNFIC 667
                     |::|.:.:.....||:||.|||.:|.|..|..:..|.:   ||:..:....||  |
  Fly   358 ---------NDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLN--C 411

  Fly   668 DCDLVWFQQW---LKNRFPQ--QAEHAVCGYPEHL-LDRH---LKSLSSSELVCVD---SPKP 718
            .|:|.||.:.   |||:..:  |.:..:|    |: ||..   ::::.:.::.|..   ||.|
  Fly   412 SCELTWFPKLLEDLKNKDDEMSQKKKPLC----HMSLDNREYFVQAMPTEKMHCAGLNVSPSP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR_RI <275..446 CDD:238064 43/162 (27%)
leucine-rich repeat 293..316 CDD:275380 5/14 (36%)
LRR_8 316..373 CDD:290566 18/72 (25%)
leucine-rich repeat 317..338 CDD:275380 7/35 (20%)
leucine-rich repeat 339..362 CDD:275380 6/22 (27%)
leucine-rich repeat 363..386 CDD:275380 6/22 (27%)
LRR_8 386..445 CDD:290566 18/59 (31%)
leucine-rich repeat 387..410 CDD:275380 8/22 (36%)
leucine-rich repeat 411..434 CDD:275380 6/23 (26%)
leucine-rich repeat 435..457 CDD:275380 7/22 (32%)
LRR_8 457..516 CDD:290566 18/58 (31%)
leucine-rich repeat 458..481 CDD:275380 8/22 (36%)
leucine-rich repeat 482..505 CDD:275380 5/22 (23%)
LRR_RI <498..669 CDD:238064 48/175 (27%)
LRR_8 504..564 CDD:290566 22/60 (37%)
leucine-rich repeat 506..529 CDD:275380 8/23 (35%)
leucine-rich repeat 530..553 CDD:275380 7/22 (32%)
leucine-rich repeat 554..577 CDD:275380 7/23 (30%)
LRR_8 576..641 CDD:290566 14/64 (22%)
leucine-rich repeat 578..604 CDD:275380 4/25 (16%)
leucine-rich repeat 607..630 CDD:275380 3/22 (14%)
leucine-rich repeat 631..652 CDD:275380 9/20 (45%)
LRRCT 665..712 CDD:214507 13/55 (24%)
IG 734..823 CDD:214652
Ig 735..823 CDD:143165
I-set 834..924 CDD:254352
Ig 851..924 CDD:299845
IG 936..1027 CDD:214652
Ig 961..1020 CDD:143165
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 5/19 (26%)
LRR_RI 93..384 CDD:238064 88/319 (28%)
leucine-rich repeat 107..129 CDD:275380 6/21 (29%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
LRR_8 154..214 CDD:290566 18/59 (31%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
LRR_8 226..286 CDD:290566 18/59 (31%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRR_8 276..335 CDD:290566 21/58 (36%)
leucine-rich repeat 276..300 CDD:275380 8/23 (35%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 19/88 (22%)
leucine-rich repeat 350..373 CDD:275380 7/51 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.