DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and CG18095

DIOPT Version :9

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:409 Identity:120/409 - (29%)
Similarity:194/409 - (47%) Gaps:24/409 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 NKLNDTTVLEIRNLLNLTKVSLKRNLLEVIPK--FIGLSGLKHLVLANNHITSISSESLAALPLL 363
            :|.|:|.|..||....||.::|....|..:..  |:....|.||.|.::.::.:...||..|..|
  Fly    25 SKCNNTEVTLIRKTELLTSLTLSNCTLPHVENGFFVRFDHLLHLELQHSGLSDLDDFSLNGLTKL 89

  Fly   364 RTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRV 428
            :.|.||.|.|.::...|......|.:|.||.|.::.::..||.....|..|:|..||:|.:....
  Fly    90 QYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDS 154

  Fly   429 FKNLNQLKKLALNFNQL-EINWSTFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQI 492
            |..|:.||.|.||.||| .|:.|.||||..:.:|.|:.|:|..::...|.....:.::.|..|.:
  Fly   155 FDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLL 219

  Fly   493 SSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTL 557
            |||.......|.:|.|||||.|.:.::|...:.....|:.||||.|.|.:...:.|..|..|:.|
  Fly   220 SSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERL 284

  Fly   558 NLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQIST 622
            |::||.:..:.:.:.|.:..|.:|::..|.|:.:.::.     |....:|..:.|..|.:::||:
  Fly   285 NISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNL-----FHFNTQLEEIILANNKIEEISS 344

  Fly   623 KAMSGLNNLEILNLGSNALA--------SIQVNAFEHMLRLNKLVFKSLN--------FICDCDL 671
            :.|...|:|..:.|..||::        |..||.|...:.|:....||||        :|...|.
  Fly   345 QMMFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADN 409

  Fly   672 VWFQQWLKNRFPQQAEHAV 690
            .|...||.....|:..::|
  Fly   410 NWSCNWLVANLVQKLPNSV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR_RI <275..446 CDD:238064 48/147 (33%)
leucine-rich repeat 293..316 CDD:275380 6/14 (43%)
LRR_8 316..373 CDD:290566 17/58 (29%)
leucine-rich repeat 317..338 CDD:275380 5/22 (23%)
leucine-rich repeat 339..362 CDD:275380 7/22 (32%)
leucine-rich repeat 363..386 CDD:275380 7/22 (32%)
LRR_8 386..445 CDD:290566 21/58 (36%)
leucine-rich repeat 387..410 CDD:275380 7/22 (32%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 14/22 (64%)
LRR_8 457..516 CDD:290566 18/58 (31%)
leucine-rich repeat 458..481 CDD:275380 5/22 (23%)
leucine-rich repeat 482..505 CDD:275380 6/22 (27%)
LRR_RI <498..669 CDD:238064 50/186 (27%)
LRR_8 504..564 CDD:290566 22/59 (37%)
leucine-rich repeat 506..529 CDD:275380 8/22 (36%)
leucine-rich repeat 530..553 CDD:275380 9/22 (41%)
leucine-rich repeat 554..577 CDD:275380 6/22 (27%)
LRR_8 576..641 CDD:290566 15/64 (23%)
leucine-rich repeat 578..604 CDD:275380 5/25 (20%)
leucine-rich repeat 607..630 CDD:275380 6/22 (27%)
leucine-rich repeat 631..652 CDD:275380 8/28 (29%)
LRRCT 665..712 CDD:214507 7/26 (27%)
IG 734..823 CDD:214652
Ig 735..823 CDD:143165
I-set 834..924 CDD:254352
Ig 851..924 CDD:299845
IG 936..1027 CDD:214652
Ig 961..1020 CDD:143165
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 5/22 (23%)
LRR_8 64..123 CDD:290566 19/58 (33%)
leucine-rich repeat 65..88 CDD:275380 7/22 (32%)
leucine-rich repeat 89..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI 115..384 CDD:238064 82/273 (30%)
LRR_8 135..195 CDD:290566 25/59 (42%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 14/22 (64%)
LRR_8 184..243 CDD:290566 18/58 (31%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
LRR_8 232..289 CDD:290566 20/56 (36%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 9/22 (41%)
LRR_8 280..339 CDD:290566 14/63 (22%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.