DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and haf

DIOPT Version :9

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster


Alignment Length:1031 Identity:220/1031 - (21%)
Similarity:336/1031 - (32%) Gaps:334/1031 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 LVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNNLV-HLILSFNEITNVNEHSF 405
            |:..||...|...:::.:...|..|.||...:..|...:|....::: :|.|..|.:.:|...:.
  Fly    85 LLYVNNSTISELPDAVFSNLSLHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADVPVEAL 149

  Fly   406 ATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINWSTFRGLE-SMKNLQLKSNKIR 469
            ..|..|..|:||.|:||.:|...|..|.:|..|.||.|.:.:..:.||||| |:|||.||..|.|
  Fly   150 KVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQR 214

  Fly   470 ALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLD 534
            .:.:.:                      :||                           :||..||
  Fly   215 KVPESI----------------------RGL---------------------------KSLAFLD 230

  Fly   535 LSNNAINEFKP----QHLDCLHRLKTLNLAHNRLQYLQENTFDCV-KNLEELNLRRNRLSWIIED 594
            ||.|.|.|...    :..|.|..|..|||..|.:|.:.|..|..| |.|..|:|..|.|:     
  Fly   231 LSQNGIKELPGAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLA----- 290

  Fly   595 QSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHM---LRLN 656
            :........|::||.||:..|.|..:...|..|...:.:|.|..|.|:|:...||.|:   ||..
  Fly   291 EFPIGAVHSLKELRVLDIGFNLLTSLPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGL 355

  Fly   657 KLVFKSLNFICDCDLVWFQQWLKN---------RFPQQAEHAVCGYPEHLLDRHLKSLSSSELVC 712
            .|..:.|:  |||.|.|..:|::|         |.||     .||.|....||...|:...||.|
  Fly   356 SLGGRFLH--CDCKLRWVAEWIRNGDLQVTSRERNPQ-----FCGTPPRFRDRGFYSIQPEELSC 413

  Fly   713 --------------VDSPKPRVEQEPDDM---LAVNAANITLECIASSPTAASLAAADELKIKWR 760
                          .|:.||.:...||.:   .......:.....||:|..:|::          
  Fly   414 PDIADAALRGPVGLADNLKPTLPSSPDSVEYETGTGTGTVGTGTAASAPVTSSVS---------- 468

  Fly   761 HDNQHVQERPAVHDGASTETQIRHDLSTNQTSIYGYLRLTNVTYESAGRYQCVVSNAFGTTYAQK 825
                           :||.|       |..|:     ..|..|.|...|..........||....
  Fly   469 ---------------SSTST-------TTPTT-----TTTTTTAEPTTRRSTTRPPTKSTTTISA 506

  Fly   826 FKISIGIHPTFLQVPSNLTLDAGEMARLVCSASGDPTPEIALQKFGGSEFPAATERRLQVIREEN 890
            ...|...:|     |.|.| ...:...:..|:|...:...:.....|.:.|...:.         
  Fly   507 TTASPASNP-----PVNGT-GTVQATSITTSSSSSSSSSTSTGHGNGKQAPGWRQG--------- 556

  Fly   891 AFLITNAKPSDSGIYTCTALSAAGEIKVNATLVVNDKPQPSIPLV-------------HQEVVV- 941
               :||.. .:||:      ..||.:         .|||.. |||             ..||.| 
  Fly   557 ---VTNGN-GNSGV------GGAGGL---------HKPQRP-PLVLGYPPQRGTRIDDANEVQVK 601

  Fly   942 -----GRTCVLQCLSETAN-------------ADFE----LEHPHREWFKENKP----------- 973
                 ..:.::|..|:|||             ..|:    ||...||:..:|.|           
  Fly   602 HAFRQDSSVIIQWDSDTANILGFRVVYRLFGEKAFKQGPPLESSEREFKIKNVPAQECIIVCVIS 666

  Fly   974 ---IHISP-TAPDGDRYYFSNNKELLVILNAQSNDAGHFRCEITDNSRTFTLQSELVVVKENLNW 1034
               :|::| |.|      :...:|:..:.:..||                  ..::.:...    
  Fly   667 LEELHVTPETVP------YQQCREVRTVASQASN------------------MDKITIAAS---- 703

  Fly  1035 VVLLVGIITVTVICVVVDCCIIWCTLRYQKKKLRMSLAAERHSTQLR------------------ 1081
             ..:.|.|.|.||                     :.:||.|.|.:|:                  
  Fly   704 -AAICGTIIVAVI---------------------VFIAASRRSRKLQSSQQKSPLPIGGLPVNCC 746

  Fly  1082 -----PRSLADLGCSYDEANHRRLTVMSTPPSEQRCLEQGLTLSYLRQTDLEAQQDHLSSKDSGT 1141
                 |..|..:.......||:..        :|.....|.::...|...:| |.|.:.|..||.
  Fly   747 GPTGSPGPLGSIATLSAFNNHKEW--------DQVSAYSGRSIPRPRIYPVE-QPDDMRSHFSGM 802

  Fly  1142 GSDAAVKRTLDDFE---------------VAMPSHKHHTDDEEEEEVEEVYEENEPPYIKHTYEV 1191
            .......|:|.|.:               .|.||:..::..|..:..:.:...:|     .....
  Fly   803 PGKVGKSRSLADGQSQHSFSNNSHRGYLGSAFPSNLVNSRPELRQSRQSLAAASE-----RMSRA 862

  Fly  1192 NYAEPEQHLFLQNNNHNYDGGGIGV---AGGVNKMVPNALLRKCSAGASGSNYSSI 1244
            :||         .:.|..:|||.|:   .||....:|.:.|...|....|...:||
  Fly   863 SYA---------GSIHGGNGGGGGLGGNGGGGGNGLPVSSLMAMSGMVGGGGPASI 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR_RI <275..446 CDD:238064 30/104 (29%)
leucine-rich repeat 293..316 CDD:275380
LRR_8 316..373 CDD:290566 8/30 (27%)
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380 4/19 (21%)
leucine-rich repeat 363..386 CDD:275380 6/22 (27%)
LRR_8 386..445 CDD:290566 20/59 (34%)
leucine-rich repeat 387..410 CDD:275380 5/23 (22%)
leucine-rich repeat 411..434 CDD:275380 10/22 (45%)
leucine-rich repeat 435..457 CDD:275380 10/22 (45%)
LRR_8 457..516 CDD:290566 10/58 (17%)
leucine-rich repeat 458..481 CDD:275380 7/22 (32%)
leucine-rich repeat 482..505 CDD:275380 2/22 (9%)
LRR_RI <498..669 CDD:238064 50/178 (28%)
LRR_8 504..564 CDD:290566 16/63 (25%)
leucine-rich repeat 506..529 CDD:275380 0/22 (0%)
leucine-rich repeat 530..553 CDD:275380 10/26 (38%)
leucine-rich repeat 554..577 CDD:275380 9/23 (39%)
LRR_8 576..641 CDD:290566 18/64 (28%)
leucine-rich repeat 578..604 CDD:275380 5/25 (20%)
leucine-rich repeat 607..630 CDD:275380 8/22 (36%)
leucine-rich repeat 631..652 CDD:275380 7/20 (35%)
LRRCT 665..712 CDD:214507 18/55 (33%)
IG 734..823 CDD:214652 15/88 (17%)
Ig 735..823 CDD:143165 15/87 (17%)
I-set 834..924 CDD:254352 14/89 (16%)
Ig 851..924 CDD:299845 10/72 (14%)
IG 936..1027 CDD:214652 22/128 (17%)
Ig 961..1020 CDD:143165 12/73 (16%)
hafNP_001356954.1 LRR <52..>252 CDD:227223 55/215 (26%)
leucine-rich repeat 86..105 CDD:275380 3/18 (17%)
leucine-rich repeat 106..129 CDD:275380 6/22 (27%)
LRR_8 131..189 CDD:338972 20/57 (35%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
leucine-rich repeat 155..178 CDD:275380 10/22 (45%)
leucine-rich repeat 179..202 CDD:275380 10/22 (45%)
leucine-rich repeat 203..225 CDD:275380 9/70 (13%)
leucine-rich repeat 226..253 CDD:275380 10/26 (38%)
LRR_8 254..337 CDD:338972 27/87 (31%)
leucine-rich repeat 254..302 CDD:275380 16/52 (31%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 8/22 (36%)
PCC 332..>413 CDD:188093 29/87 (33%)
PRK10927 <1061..>1097 CDD:236797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.