DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and LOC3292317

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_560029.3 Gene:LOC3292317 / 3292317 VectorBaseID:AGAMI1_007276 Length:256 Species:Anopheles gambiae


Alignment Length:133 Identity:43/133 - (32%)
Similarity:71/133 - (53%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 NNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINWSTFRGLESMKNLQLKSNKIRALQD 473
            :.:.:|::|:|.||.:.|...|..| |:||.:. |.|..|.:.|:.|..::.|.|..|.:..:..
Mosquito   108 DTIIELDVSDNWLSRVYIDPEKRYN-LRKLIMR-NNLLTNIAGFKYLIKLEELNLSENMLHTVNF 170

  Fly   474 GVFYVMHKIETIDLAMNQISSLS-RQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSN 537
            .||..:..|..||||.|:|...| .|.:.:|..|..||::.|.::.:::..|.| .||..|:|:.
Mosquito   171 VVFSFIPYIRLIDLARNRILFTSGGQSVISLDFLETLNMAENKLTTLDIGVWIF-PSLLTLNLTG 234

  Fly   538 NAI 540
            |.|
Mosquito   235 NPI 237

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 43/133 (32%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380
leucine-rich repeat 363..386 CDD:275380