DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Rtn4rl2

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_852045.1 Gene:Rtn4rl2 / 311169 RGDID:727797 Length:420 Species:Rattus norvegicus


Alignment Length:360 Identity:91/360 - (25%)
Similarity:136/360 - (37%) Gaps:93/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 TLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTL-PIRV 428
            |:....|...::.| |.|.|..  .|.|..|.|.::...:|..  ||..|.|.:|.|||: |   
  Rat    43 TVSCQANNFSSVPL-SLPPSTQ--RLFLQNNLIRSLRPGTFGP--NLLTLWLFSNNLSTIYP--- 99

  Fly   429 FKNLNQLKKLALNFNQLEINWSTFRGLESMKNLQLKSNK-IRALQDGVFYVMHKIETIDLAMNQI 492
                                 .|||.|::::.|.|..|: :|:|:...|..:.:::::.|...|:
  Rat   100 ---------------------GTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQL 143

  Fly   493 SSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTL 557
            |||.......|..|::|.|.                                             
  Rat   144 SSLPGNIFRGLVSLQYLYLQ--------------------------------------------- 163

  Fly   558 NLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQIST 622
               .|.|.:||::.|..:.||..|.|..|||..:.|.     .|:||..|.||.||||.|:.:..
  Rat   164 ---ENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEH-----VFRGLGSLDRLLLHGNRLQGVHR 220

  Fly   623 KAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLNFICDCDL----VWFQQWLKNRFP 683
            .|..||:.|.||.|.:|:|||:...|...:..|..|...:..:.|||..    .|||     |..
  Rat   221 AAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQ-----RAR 280

  Fly   684 QQAEHAVCGYPEHLLDRHLKSLSSSELVCVDSPKP 718
            ..:....|..|.....|.|::|..::......|.|
  Rat   281 VSSSDVTCATPPERQGRDLRTLRDTDFQACPPPTP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 71/278 (26%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380
leucine-rich repeat 363..386 CDD:275380 6/20 (30%)
leucine-rich repeat 387..410 CDD:275380 5/22 (23%)
leucine-rich repeat 411..434 CDD:275380 8/23 (35%)
leucine-rich repeat 435..457 CDD:275380 4/21 (19%)
leucine-rich repeat 458..481 CDD:275380 6/23 (26%)
leucine-rich repeat 482..505 CDD:275380 6/22 (27%)
leucine-rich repeat 506..529 CDD:275380 3/22 (14%)
leucine-rich repeat 530..553 CDD:275380 0/22 (0%)
leucine-rich repeat 554..577 CDD:275380 5/22 (23%)
leucine-rich repeat 578..604 CDD:275380 8/25 (32%)
leucine-rich repeat 607..630 CDD:275380 11/22 (50%)
leucine-rich repeat 631..652 CDD:275380 9/20 (45%)
LRRCT 665..712 CDD:214507 12/50 (24%)
Ig_3 717..816 CDD:464046 1/2 (50%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
Rtn4rl2NP_852045.1 LRR <55..>261 CDD:443914 75/287 (26%)
LRR 1 61..82 6/22 (27%)
leucine-rich repeat 62..83 CDD:275380 5/24 (21%)
LRR 2 83..104 11/44 (25%)
leucine-rich repeat 84..107 CDD:275380 12/46 (26%)
LRR 3 107..129 6/21 (29%)
leucine-rich repeat 108..132 CDD:275380 6/23 (26%)
LRR 4 132..153 5/20 (25%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
LRR 5 156..177 8/68 (12%)
leucine-rich repeat 157..180 CDD:275380 8/70 (11%)
LRR 6 180..201 9/25 (36%)
leucine-rich repeat 181..204 CDD:275380 10/27 (37%)
LRR 7 204..225 9/20 (45%)
leucine-rich repeat 205..228 CDD:275380 11/22 (50%)
LRR 8 228..249 9/20 (45%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
LRRCT 261..311 CDD:214507 12/54 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..390 7/30 (23%)
PHA03247 289..>369 CDD:223021 6/27 (22%)
Important for interaction with MAG. /evidence=ECO:0000269|PubMed:19420245 315..327 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.