DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Nyx

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001094437.1 Gene:Nyx / 302516 RGDID:1561300 Length:476 Species:Rattus norvegicus


Alignment Length:553 Identity:126/553 - (22%)
Similarity:190/553 - (34%) Gaps:194/553 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 KALEAAAAAAKASNKYNIDCPKDCKCLNV----LFDCDKLHLERVPV-LPSYVQTLHLANNKLND 305
            :|.||...|          ||..|.|.||    ...||:..|:|||. .|               
  Rat    17 RATEACLRA----------CPAACTCSNVERGCSVRCDRAGLQRVPTEFP--------------- 56

  Fly   306 TTVLEIRNLLNLTKVSLKRNLLEVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSR 370
                     .....:.|.||.|.:                      :...:...||.||.|.|..
  Rat    57 ---------CEAASIDLDRNGLRI----------------------LGERAFGTLPSLRCLSLRH 90

  Fly   371 NKLHTIELNSFPKSNNLVHLILSFN-EITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQ 434
            |.|..|...:|.....|..|.|:.| |:..::..:||.|..|..|:|:..||.::|.|:...|..
  Rat    91 NNLSFITPGAFKGLPRLAELRLAHNGELRYLHVRTFAALGRLRRLDLAACRLFSVPERLLAELPA 155

  Fly   435 LKKLALNFNQLEINWSTFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQG 499
            |::|....|.........|||.::.:...:.::|.|                     ::|.|..|
  Rat   156 LRELTAFDNLFRRVPGALRGLANLTHAHFERSRIEA---------------------VASSSLLG 199

  Fly   500 LFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTLNLAHNRL 564
                                                               :.||::|:|..||:
  Rat   200 ---------------------------------------------------MRRLRSLSLQANRV 213

  Fly   565 QYLQENTF-DCVKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGL 628
            :.:....| |||. ||.|.|..|.|:.:     .||.|:|||:||.|:|.||.|..::....|.|
  Rat   214 RAVHAGAFGDCVA-LEHLLLNDNLLASL-----PAAAFRGLRRLRTLNLGGNALGSVARGWFSDL 272

  Fly   629 NNLEILNLGSNALASIQVNAFEHM-------LRLNKLV-----------FKSLNFI------CDC 669
            ..||:|.|..|::..::..||:::       |..|:|.           |....|:      |||
  Rat   273 AELELLYLDRNSITFVEEGAFQNLSGLLALHLNGNRLTVLSWAAFQPGFFLGRLFLFRNPWRCDC 337

  Fly   670 DLVWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSL---SSSELVCVD-------------SPKP 718
            .|.|.:.|::.  ..:.....|..|..:..:.|..:   .||:.:|||             ||:|
  Rat   338 HLEWLRDWMEG--SGRVADVACASPGSVAGQDLSQVVFERSSDGICVDPDELNFTTFSPGPSPEP 400

  Fly   719 ------RVEQEPDDMLAVNA-----ANITLECI 740
                  |.......:||..|     ||.|.|.:
  Rat   401 VATTVSRFSSLLSKLLAPRAPVEEVANTTWELV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 77/350 (22%)
leucine-rich repeat 293..316 CDD:275380 0/22 (0%)
leucine-rich repeat 317..338 CDD:275380 4/20 (20%)
leucine-rich repeat 339..362 CDD:275380 1/22 (5%)
leucine-rich repeat 363..386 CDD:275380 8/22 (36%)
leucine-rich repeat 387..410 CDD:275380 8/23 (35%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 6/21 (29%)
leucine-rich repeat 458..481 CDD:275380 2/22 (9%)
leucine-rich repeat 482..505 CDD:275380 3/22 (14%)
leucine-rich repeat 506..529 CDD:275380 0/22 (0%)
leucine-rich repeat 530..553 CDD:275380 0/22 (0%)
leucine-rich repeat 554..577 CDD:275380 9/23 (39%)
leucine-rich repeat 578..604 CDD:275380 9/25 (36%)
leucine-rich repeat 607..630 CDD:275380 9/22 (41%)
leucine-rich repeat 631..652 CDD:275380 7/20 (35%)
LRRCT 665..712 CDD:214507 12/55 (22%)
Ig_3 717..816 CDD:464046 9/35 (26%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
NyxNP_001094437.1 LRRNT 25..56 CDD:214470 13/40 (33%)
leucine-rich repeat 63..82 CDD:275380 5/40 (13%)
LRR 79..>326 CDD:443914 79/324 (24%)
leucine-rich repeat 83..106 CDD:275380 8/22 (36%)
leucine-rich repeat 107..131 CDD:275380 8/23 (35%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..178 CDD:275380 6/21 (29%)
leucine-rich repeat 179..202 CDD:275380 5/94 (5%)
leucine-rich repeat 203..226 CDD:275380 8/22 (36%)
leucine-rich repeat 227..250 CDD:275380 11/27 (41%)
leucine-rich repeat 251..274 CDD:275380 9/22 (41%)
leucine-rich repeat 275..296 CDD:275380 7/20 (35%)
leucine-rich repeat 299..318 CDD:275380 3/18 (17%)
LRRCT 331..>366 CDD:214507 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.