DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Rtn4rl2

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_006499655.1 Gene:Rtn4rl2 / 269295 MGIID:2669796 Length:480 Species:Mus musculus


Alignment Length:382 Identity:96/382 - (25%)
Similarity:142/382 - (37%) Gaps:105/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 SLAALPLLR--------------TLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFA 406
            :|.|||.:.              |:....|...::.| |.|.|..  .|.|..|.|.::...:|.
Mouse    80 TLLALPSVTPSCPMLCTCYSSPPTVSCQANNFSSVPL-SLPPSTQ--RLFLQNNLIRSLRPGTFG 141

  Fly   407 TLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINWSTFRGLESMKNLQLKSNK-IRA 470
            .  ||..|.|.:|.|||                       |:..|||.|::::.|.|..|: :|:
Mouse   142 P--NLLTLWLFSNNLST-----------------------IHPGTFRHLQALEELDLGDNRHLRS 181

  Fly   471 LQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDL 535
            |:...|..:.:::::.|...|:|||.......|..|::|.|.                       
Mouse   182 LEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQ----------------------- 223

  Fly   536 SNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAP 600
                                     .|.|.:||::.|..:.||..|.|..|||..:.|.     .
Mouse   224 -------------------------ENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEH-----V 258

  Fly   601 FKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLNF 665
            |:||..|.||.||||.|:.:...|..||:.|.||.|.:|:|||:...|...:..|..|...:..:
Mouse   259 FRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPW 323

  Fly   666 ICDCDL----VWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSLSSSELVCVDSPKP 718
            .|||..    .|||     |....:....|..|.....|.|::|..|:......|.|
Mouse   324 ACDCRARPLWAWFQ-----RARVSSSDVTCATPPERQGRDLRALRDSDFQACPPPTP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 75/300 (25%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380 3/5 (60%)
leucine-rich repeat 363..386 CDD:275380 6/36 (17%)
leucine-rich repeat 387..410 CDD:275380 5/22 (23%)
leucine-rich repeat 411..434 CDD:275380 7/22 (32%)
leucine-rich repeat 435..457 CDD:275380 5/21 (24%)
leucine-rich repeat 458..481 CDD:275380 6/23 (26%)
leucine-rich repeat 482..505 CDD:275380 6/22 (27%)
leucine-rich repeat 506..529 CDD:275380 3/22 (14%)
leucine-rich repeat 530..553 CDD:275380 0/22 (0%)
leucine-rich repeat 554..577 CDD:275380 5/22 (23%)
leucine-rich repeat 578..604 CDD:275380 8/25 (32%)
leucine-rich repeat 607..630 CDD:275380 11/22 (50%)
leucine-rich repeat 631..652 CDD:275380 9/20 (45%)
LRRCT 665..712 CDD:214507 13/50 (26%)
Ig_3 717..816 CDD:464046 1/2 (50%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
Rtn4rl2XP_006499655.1 LRR <115..>321 CDD:443914 75/286 (26%)
leucine-rich repeat 122..143 CDD:275380 5/24 (21%)
leucine-rich repeat 144..167 CDD:275380 12/45 (27%)
leucine-rich repeat 168..192 CDD:275380 6/23 (26%)
leucine-rich repeat 193..216 CDD:275380 6/22 (27%)
leucine-rich repeat 217..240 CDD:275380 8/70 (11%)
leucine-rich repeat 241..264 CDD:275380 10/27 (37%)
leucine-rich repeat 265..288 CDD:275380 11/22 (50%)
leucine-rich repeat 289..312 CDD:275380 9/22 (41%)
LRRCT 321..371 CDD:214507 13/54 (24%)
PHA03247 349..>429 CDD:223021 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.