DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Lingo3

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001013780.2 Gene:Lingo3 / 237403 MGIID:3609246 Length:589 Species:Mus musculus


Alignment Length:667 Identity:152/667 - (22%)
Similarity:231/667 - (34%) Gaps:233/667 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 VSLKRNLLEVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKS 384
            |:..|..|..||:.|. :..:.|.|:.|.|..::...||:||.|..|||:.              
Mouse    37 VACGRRRLTAIPEGIP-AETRMLELSRNRIRCLNPGDLASLPTLEELDLNH-------------- 86

  Fly   385 NNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINW 449
                      |.|.:|...:||.|..|..|.|..|:|..:|..||.:|:.|..|.|:.|:|.|..
Mouse    87 ----------NVIAHVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTHLDSLTLLDLSENKLVILL 141

  Fly   450 S-TFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNL-----TKLRH 508
            . :|:.|.|::.|::..|.:..:....|..:..:..:.|....::|||.:.|.:|     .:|||
Mouse   142 DFSFQDLRSLQRLEVGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRH 206

  Fly   509 LNLS---------FNAISRIEVDTWEFTQ-----SLEVLDLSNNAINEF-----------KPQHL 548
            |.::         ...:|.:|:|.|...:     ||..|:|::.:|...           :..||
Mouse   207 LAIAALEDQNFQKLPGLSHLEIDNWPLLEEVAPGSLRGLNLTSLSITHTNITAVPAAALRQQAHL 271

  Fly   549 DCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLH 613
            .|      |||:||.:..:...:|..:..|.||:|....|: :||.|:    |.|||::|.|:|.
Mouse   272 TC------LNLSHNPISMVPRGSFRDLVRLRELHLAGALLA-VIEPQA----FVGLRQIRLLNLS 325

  Fly   614 GNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLNFICDCDLVWFQQWL 678
            .|.|..:.......:|.||.|.:..|.||                        |||.|:|..|..
Mouse   326 DNLLSTLEENTFHSVNTLETLRVDGNPLA------------------------CDCRLLWIVQRR 366

  Fly   679 K-----NRFPQQAEHAVCGYPEHLLDRHLKSLSSSEL----VCVDSPKPRVEQEPDDMLAVNAAN 734
            |     .|.|      .|..|..:....|.:|..|.|    ||   .||::.             
Mouse   367 KTLNFDGRLP------ACATPAEVRGDALHNLPDSVLFEYFVC---RKPKIR------------- 409

  Fly   735 ITLECIASSPTAASLAAADELKIKWRHDNQHVQERPAVHDGASTETQIRHDLSTNQTSIYGYLRL 799
                                                        |.:::|               
Mouse   410 --------------------------------------------ERRLQH--------------- 415

  Fly   800 TNVTYESAGRYQCVVSNAFGTTYAQKFKISIGIHPTFLQVPSNLTLDAGEMARLVCSASGDPTPE 864
                                                       :|...|:..|.:|.|.|:|.|.
Mouse   416 -------------------------------------------VTATEGDDVRFLCRAEGEPAPT 437

  Fly   865 IALQKFGGSEFPAATERRLQVIREENAFLITNAKPSDSGIYTCTALSAAGEIKVNATLVVNDKPQ 929
            :|..........||:..|.:|: ......|.:.:|.|||.|||.|.:|.|.....|||.|    |
Mouse   438 VAWVTPQHHSVTAASRGRARVL-PGGTLTIADTRPQDSGTYTCVASNAGGNDTYFATLTV----Q 497

  Fly   930 PSIPLV----HQEVVVG 942
            |:....    |.|..||
Mouse   498 PAANRTQGDGHNETQVG 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 95/352 (27%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380 6/17 (35%)
leucine-rich repeat 339..362 CDD:275380 7/22 (32%)
leucine-rich repeat 363..386 CDD:275380 4/22 (18%)
leucine-rich repeat 387..410 CDD:275380 6/22 (27%)
leucine-rich repeat 411..434 CDD:275380 9/22 (41%)
leucine-rich repeat 435..457 CDD:275380 8/22 (36%)
leucine-rich repeat 458..481 CDD:275380 3/22 (14%)
leucine-rich repeat 482..505 CDD:275380 6/27 (22%)
leucine-rich repeat 506..529 CDD:275380 8/36 (22%)
leucine-rich repeat 530..553 CDD:275380 7/33 (21%)
leucine-rich repeat 554..577 CDD:275380 6/22 (27%)
leucine-rich repeat 578..604 CDD:275380 9/25 (36%)
leucine-rich repeat 607..630 CDD:275380 5/22 (23%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 15/55 (27%)
Ig_3 717..816 CDD:464046 4/98 (4%)
Ig 835..924 CDD:472250 27/88 (31%)
Ig strand B 851..855 CDD:409353 1/3 (33%)
Ig strand C 864..868 CDD:409353 1/3 (33%)
Ig strand E 890..894 CDD:409353 0/3 (0%)
Ig strand F 904..909 CDD:409353 3/4 (75%)
Ig strand G 917..920 CDD:409353 0/2 (0%)
Ig_3 927..1013 CDD:464046 6/20 (30%)
Lingo3NP_001013780.2 LRRNT 23..55 CDD:214470 6/18 (33%)
leucine-rich repeat 34..53 CDD:275380 6/16 (38%)
LRR 1 54..75 5/20 (25%)
leucine-rich repeat 55..78 CDD:275380 7/22 (32%)
LRR <56..>349 CDD:443914 88/327 (27%)
LRR 2 78..99 8/44 (18%)
leucine-rich repeat 79..102 CDD:275380 10/46 (22%)
LRR 3 102..123 8/20 (40%)
leucine-rich repeat 103..150 CDD:275380 17/46 (37%)
LRR 4 126..147 7/20 (35%)
LRR 5 150..171 4/20 (20%)
leucine-rich repeat 151..174 CDD:275380 3/22 (14%)
LRR 6 174..195 5/20 (25%)
leucine-rich repeat 175..198 CDD:275380 6/22 (27%)
leucine-rich repeat 199..222 CDD:275380 4/22 (18%)
LRR 7 206..227 3/20 (15%)
leucine-rich repeat 223..246 CDD:275380 6/22 (27%)
LRR 8 246..267 2/20 (10%)
leucine-rich repeat 247..270 CDD:275380 2/22 (9%)
LRR 9 270..291 9/26 (35%)
leucine-rich repeat 271..292 CDD:275380 8/26 (31%)
LRR 10 294..315 9/25 (36%)
leucine-rich repeat 295..318 CDD:275380 11/27 (41%)
LRR 11 318..339 5/20 (25%)
leucine-rich repeat 321..342 CDD:275380 4/20 (20%)
PCC 331..>405 CDD:188093 24/106 (23%)
Ig 407..496 CDD:472250 29/204 (14%)
Ig strand B 424..428 CDD:409353 1/3 (33%)
Ig strand C 437..441 CDD:409353 1/3 (33%)
Ig strand E 462..466 CDD:409353 0/3 (0%)
Ig strand F 476..481 CDD:409353 3/4 (75%)
Ig strand G 489..492 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.