DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Lrrtm3

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_848793.1 Gene:Lrrtm3 / 216028 MGIID:2389177 Length:582 Species:Mus musculus


Alignment Length:328 Identity:68/328 - (20%)
Similarity:101/328 - (30%) Gaps:98/328 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 KSQILQSCANVSPRGIFVCGTNSSNVGLTVTVRTEKGVGASLEAGALVLADQGVCCIDEFDKMSG 519
            |||.|.:.:|.||..:.....|..|            ..||:|.||.:|:...       :..|.
Mouse   347 KSQSLHTSSNGSPHPVKKVQKNFKN------------NYASVECGAKILSANN-------EAKST 392

  Fly   520 HSGLLEVMEQRSVSVAKAGVICTVPARTTVLAAANPAGGHYNKAKTVSENLKLHPALLSRF---- 580
            .:.|:|.|:                     |...||..........:.|.:::....::.|    
Mouse   393 SAILMENMD---------------------LYMLNPCSTKIWFVIELCEPIQVKQLDIANFELFS 436

  Fly   581 ----DLVFILLDR--------------SNERT------DNLLTAHIQKVHGLAKAGSSHLQPQPS 621
                |.:..:.||              .:|||      |..|.|...||..|:..||.|..|...
Mouse   437 STPRDFLVSISDRYPTNKWIKLGTFHARDERTVQSFPLDEQLYAKYVKVELLSHFGSEHFCPLSL 501

  Fly   622 HPFF--------DASGHCSYEEEGEPPLEERLRLAPGEQMDLLPPEIVQKYIGYARKNVQPKLTA 678
            ...|        |......|..|....|:|.....||    .||.|      ..|.||:....|.
Mouse   502 IRVFGTSMVEEYDEIADSQYTSERAEYLDEDYDYPPG----YLPSE------DKASKNLLGSATN 556

  Fly   679 KAAEELREFFVELRRAHNHMDMIPVTTRQLEGLI-----RLTQARAKIDLSPEATVA---HVRDV 735
            .....:......:......::    ...:|||.:     .:|||..:..|:|:.|..   |..||
Mouse   557 AILNMVNNIAANVLGGKPELE----DGAELEGNVSSGTENVTQASTETTLTPDPTPTEQPHTLDV 617

  Fly   736 LAI 738
            |.:
Mouse   618 LEL 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 44/222 (20%)
leucine-rich repeat 293..316 CDD:275380
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380
leucine-rich repeat 363..386 CDD:275380
leucine-rich repeat 387..410 CDD:275380
leucine-rich repeat 411..434 CDD:275380
leucine-rich repeat 435..457 CDD:275380 1/1 (100%)
leucine-rich repeat 458..481 CDD:275380 6/22 (27%)
leucine-rich repeat 482..505 CDD:275380 6/22 (27%)
leucine-rich repeat 506..529 CDD:275380 4/22 (18%)
leucine-rich repeat 530..553 CDD:275380 1/22 (5%)
leucine-rich repeat 554..577 CDD:275380 3/22 (14%)
leucine-rich repeat 578..604 CDD:275380 10/53 (19%)
leucine-rich repeat 607..630 CDD:275380 7/30 (23%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 7/46 (15%)
Ig_3 717..816 CDD:464046 8/25 (32%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
Lrrtm3NP_848793.1 LRRNT 33..61 CDD:214470
LRR 59..339 CDD:443914
LRR 1 63..83
leucine-rich repeat 66..86 CDD:275380
LRR 2 86..107
leucine-rich repeat 87..110 CDD:275380
LRR 3 110..131
leucine-rich repeat 111..134 CDD:275380
LRR 4 134..155
leucine-rich repeat 135..158 CDD:275380
LRR 5 158..179
leucine-rich repeat 159..182 CDD:275380
LRR 6 182..203
leucine-rich repeat 183..206 CDD:275380
LRR 7 206..226
leucine-rich repeat 207..230 CDD:275380
LRR 8 230..251
leucine-rich repeat 231..254 CDD:275380
LRR 9 254..275
leucine-rich repeat 255..279 CDD:275380
LRR 10 279..300
leucine-rich repeat 280..300 CDD:275380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..410 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.