DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and LINGO2

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_689783.1 Gene:LINGO2 / 158038 HGNCID:21207 Length:606 Species:Homo sapiens


Alignment Length:835 Identity:172/835 - (20%)
Similarity:272/835 - (32%) Gaps:303/835 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 IDCPKDCKCLNVLFDCDKLHLERVPVLPSYVQTLHLANNKLNDTTVLEIRNLLNLTKVSLKRNLL 327
            |.||..|:|                          .|.||                .||..|..|
Human    26 IGCPARCEC--------------------------SAQNK----------------SVSCHRRRL 48

  Fly   328 EVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNNLVHLIL 392
            ..||:.|.:. .|.|.|:.|.:.|::.|...:.|||..:|||.|.:..:|..:|....||..|.|
Human    49 IAIPEGIPIE-TKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRL 112

  Fly   393 SFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQL-EINWSTFRGLE 456
            ..|.:..|....|..|:|||.|::|.|::..|...:|::|:.||.|.:..|.| .|:...|.||.
Human   113 KGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLL 177

  Fly   457 SMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNLSFNAISRIEV 521
            |::.|.|:...:.|:.......:..:.::.|....|:::.......|..|:||          |:
Human   178 SLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHL----------EI 232

  Fly   522 DTWEFTQSLEVLDL----SNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELN 582
            |.|      .:||:    |...:|            |.:|::.:..|..:....|..:..|..||
Human   233 DYW------PLLDMMPANSLYGLN------------LTSLSVTNTNLSTVPFLAFKHLVYLTHLN 279

  Fly   583 LRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVN 647
            |..|.:|.|     .|..|..|.:|:.|.:.|..|:.|...:..||..|.:||:..|.|.:::.|
Human   280 LSYNPISTI-----EAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEEN 339

  Fly   648 AFEHMLRLNKLVFKSLNFICDCDLVWFQQWLKNRFPQ---QAEHAVCGYPEHLLDRHLKSLSSSE 709
            .|.....|..|...:....|||.|:|..|    |.|.   ..:..:|..|:.:.:|..|...|:.
Human   340 VFSSPRALEVLSINNNPLACDCRLLWILQ----RQPTLQFGGQQPMCAGPDTIRERSFKDFHSTA 400

  Fly   710 L----VCVDSPKPRVEQEPDDMLAVNAANITLECIASSPTAASLAAADELKIKWRHDNQHVQERP 770
            |    .|   .||::.                                                 
Human   401 LSFYFTC---KKPKIR------------------------------------------------- 413

  Fly   771 AVHDGASTETQIRHDLSTNQTSIYGYLRLTNVTYESAGRYQCVVSNAFGTTYAQKFKISIGIHPT 835
                    |.:::|                                                   
Human   414 --------EKKLQH--------------------------------------------------- 419

  Fly   836 FLQVPSNLTLDAGEMARLVCSASGDPTPEIALQKFGGSEFPAATERRLQVIREEN---------A 891
                   |.:|.|:..:|.|||.|||.|.|:.          .|.||..:..:.|         .
Human   420 -------LLVDEGQTVQLECSADGDPQPVISW----------VTPRRRFITTKSNGRATVLGDGT 467

  Fly   892 FLITNAKPSDSGIYTCTALSAAGEIKVNATLVVNDKPQPSIPLVHQEVVVGRTCVLQCLSETANA 956
            ..|..|:..|||:|.|.|.:|||.....|:|.|....                            
Human   468 LEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFA---------------------------- 504

  Fly   957 DFELEHPHREWFKENKPIHISPTAPDGDRYYFSNNKELLVILNAQSNDAGHFRCEITD--NSRTF 1019
                                      .||:.::|...:.:   ..|||.      |::  |:.||
Human   505 --------------------------SDRFLYANRTPMYM---TDSNDT------ISNGTNANTF 534

  Fly  1020 TLQSELVVVKENLNWVVLLVGIITVTVICVVVDCCIIWCTLRYQKKKLRMSLAAE 1074
            :|..:.::|...:.         ..|.:.||:.|.::.......|.|.:.|:..|
Human   535 SLDLKTILVSTAMG---------CFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLE 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 93/353 (26%)
leucine-rich repeat 293..316 CDD:275380 3/22 (14%)
leucine-rich repeat 317..338 CDD:275380 7/20 (35%)
leucine-rich repeat 339..362 CDD:275380 6/22 (27%)
leucine-rich repeat 363..386 CDD:275380 7/22 (32%)
leucine-rich repeat 387..410 CDD:275380 7/22 (32%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 9/22 (41%)
leucine-rich repeat 458..481 CDD:275380 3/22 (14%)
leucine-rich repeat 482..505 CDD:275380 3/22 (14%)
leucine-rich repeat 506..529 CDD:275380 6/22 (27%)
leucine-rich repeat 530..553 CDD:275380 4/26 (15%)
leucine-rich repeat 554..577 CDD:275380 4/22 (18%)
leucine-rich repeat 578..604 CDD:275380 9/25 (36%)
leucine-rich repeat 607..630 CDD:275380 7/22 (32%)
leucine-rich repeat 631..652 CDD:275380 7/20 (35%)
LRRCT 665..712 CDD:214507 14/53 (26%)
Ig_3 717..816 CDD:464046 4/98 (4%)
Ig 835..924 CDD:472250 29/97 (30%)
Ig strand B 851..855 CDD:409353 1/3 (33%)
Ig strand C 864..868 CDD:409353 1/3 (33%)
Ig strand E 890..894 CDD:409353 1/12 (8%)
Ig strand F 904..909 CDD:409353 2/4 (50%)
Ig strand G 917..920 CDD:409353 0/2 (0%)
Ig_3 927..1013 CDD:464046 6/85 (7%)
LINGO2NP_689783.1 LRRNT 27..60 CDD:214470 14/75 (19%)
leucine-rich repeat 39..57 CDD:275380 8/33 (24%)
LRR 48..>340 CDD:443914 88/325 (27%)
LRR 1 58..79 6/21 (29%)
leucine-rich repeat 59..82 CDD:275380 6/22 (27%)
LRR 2 82..103 8/20 (40%)
leucine-rich repeat 83..106 CDD:275380 7/22 (32%)
LRR 3 106..127 7/20 (35%)
leucine-rich repeat 107..130 CDD:275380 7/22 (32%)
LRR 4 130..151 8/20 (40%)
leucine-rich repeat 131..154 CDD:275380 8/22 (36%)
LRR 5 154..175 7/20 (35%)
leucine-rich repeat 155..178 CDD:275380 9/22 (41%)
LRR 6 178..199 4/20 (20%)
leucine-rich repeat 179..202 CDD:275380 3/22 (14%)
LRR 7 202..223 2/20 (10%)
leucine-rich repeat 203..250 CDD:275380 12/62 (19%)
LRR 8 226..247 9/36 (25%)
LRR 9 250..271 5/32 (16%)
leucine-rich repeat 251..274 CDD:275380 4/22 (18%)
LRR 10 274..295 9/25 (36%)
leucine-rich repeat 275..298 CDD:275380 10/27 (37%)
LRR 11 298..319 5/20 (25%)
leucine-rich repeat 299..322 CDD:275380 7/22 (32%)
LRR 12 322..343 7/20 (35%)
leucine-rich repeat 323..343 CDD:275380 7/19 (37%)
LRRCT 355..408 CDD:214507 15/59 (25%)
Ig 411..500 CDD:472250 31/213 (15%)
Ig strand B 428..432 CDD:409353 1/3 (33%)
Ig strand C 441..445 CDD:409353 1/13 (8%)
Ig strand E 466..470 CDD:409353 0/3 (0%)
Ig strand F 480..485 CDD:409353 2/4 (50%)
Ig strand G 493..496 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.