DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and CHADL

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_054181131.1 Gene:CHADL / 150356 HGNCID:25165 Length:771 Species:Homo sapiens


Alignment Length:715 Identity:150/715 - (20%)
Similarity:231/715 - (32%) Gaps:258/715 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LEAAAAAAKASNKYNIDCPKDCKCLNVL--FDCDKLHLERVP-VLPSYVQTLHLANNKLNDTTVL 309
            |.|.|..|.|..     ||:.|.|.|..  ..|...:|..|| .:|...|.|.|..|.|......
Human    21 LLAPARQAAAQR-----CPQACICDNSRRHVACRYQNLTEVPDAIPELTQRLDLQGNLLKVIPAA 80

  Fly   310 EIRNLLNLTKVSLKRNLLEVIPK--FIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNK 372
            ..:.:.:||.:.|:...:|::.:  |.||..|..|.||:||:..:..|:|..|..||.|:|..|.
Human    81 AFQGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASNHLRELPQEALDGLGSLRRLELEGNA 145

  Fly   373 LHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKK 437
            |..:...:|.....|..|.|:.|.:..:...:|..|..:..|.||:|.||.|.......|..|::
Human   146 LEELRPGTFGALGALATLNLAHNALVYLPAMAFQGLLRVRWLRLSHNALSVLAPEALAGLPALRR 210

  Fly   438 LALNFNQLEI-------------------NWSTFRG------LESMKNLQLKSNKIRALQDGVFY 477
            |:|:.|:|:.                   |..|:.|      |..::.|.|....::||....|.
Human   211 LSLHHNELQALPGPVLSQARGLARLELGHNPLTYAGEEDGLALPGLRELLLDGGALQALGPRAFA 275

  Fly   478 VMHKIETIDLAMNQISSL-SRQGLFNLTKLRHLN------------LSFNAISRIEVD------- 522
            ...::.|:||..||:.:| ..||...|.:||...            |.:.|.:|:..|       
Human   276 HCPRLHTLDLRGNQLDTLPPLQGPGQLRRLRLQGNPLWCGCQARPLLEWLARARVRSDGACQGPR 340

  Fly   523 -----------TWE--------------------------------------------------- 525
                       .|:                                                   
Human   341 RLRGEALDALRPWDLRCPGDAAQEEEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVCVPE 405

  Fly   526 -----------------FTQSLEVLDLSNN------------------------AINEFKPQHLD 549
                             |....::|||..|                        .|.|.:...|.
Human   406 SRHSSCEGCGLQAVPRGFPSDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALA 470

  Fly   550 CLHRLKTLNLAHNRLQ----------------------------------------YLQENTFDC 574
            .|.||..|.|:.|:|.                                        :||:|..|.
Human   471 GLGRLIYLYLSDNQLAGLSAAALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDR 535

  Fly   575 V--------------------------------KNLEELNLRRNRLSWI-----------IEDQS 596
            :                                :.||:|:|.||:|..:           :|.|.
Human   536 LAPGDLGRTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQL 600

  Fly   597 AAAPFKGL---------RKLRRLDLHGNNLKQISTKAMSGLN-NLEILNLGSNALASIQVNAFEH 651
            :..|.:.|         |.|:.|.|:.:.|:||...|.|||. .|:.|:|..|.|.::.  |...
Human   601 SGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPGLQSLHLQKNQLRALP--ALPS 663

  Fly   652 MLRLNKLVFKSLNFICDCDLVWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSLSSSELVCVDSP 716
            :.:|..:...|..|.|||.|:...:||...  .....|.|..|.:...:.:|:.::   |..|.|
Human   664 LSQLELIDLSSNPFHCDCQLLPLHRWLTGL--NLRVGATCATPPNARGQRVKAAAA---VFEDCP 723

  Fly   717  716
            Human   724  723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 117/591 (20%)
leucine-rich repeat 293..316 CDD:275380 5/22 (23%)
leucine-rich repeat 317..338 CDD:275380 7/22 (32%)
leucine-rich repeat 339..362 CDD:275380 9/22 (41%)
leucine-rich repeat 363..386 CDD:275380 7/22 (32%)
leucine-rich repeat 387..410 CDD:275380 6/22 (27%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 9/46 (20%)
leucine-rich repeat 458..481 CDD:275380 5/22 (23%)
leucine-rich repeat 482..505 CDD:275380 9/23 (39%)
leucine-rich repeat 506..529 CDD:275380 8/120 (7%)
leucine-rich repeat 530..553 CDD:275380 8/46 (17%)
leucine-rich repeat 554..577 CDD:275380 9/94 (10%)
leucine-rich repeat 578..604 CDD:275380 10/36 (28%)
leucine-rich repeat 607..630 CDD:275380 10/23 (43%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 11/46 (24%)
Ig_3 717..816 CDD:464046 150/715 (21%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
CHADLXP_054181131.1 LRRNT 33..65 CDD:214470 10/31 (32%)
leucine-rich repeat 44..62 CDD:275380 4/17 (24%)
leucine-rich repeat 64..87 CDD:275380 5/22 (23%)
LRR_8 65..146 CDD:404697 26/80 (33%)
leucine-rich repeat 88..135 CDD:275380 16/46 (35%)
LRR <128..>312 CDD:443914 49/183 (27%)
leucine-rich repeat 136..159 CDD:275380 7/22 (32%)
leucine-rich repeat 160..183 CDD:275380 6/22 (27%)
leucine-rich repeat 184..207 CDD:275380 8/22 (36%)
leucine-rich repeat 208..231 CDD:275380 5/22 (23%)
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
leucine-rich repeat 256..279 CDD:275380 5/22 (23%)
LRRNT 395..429 CDD:214470 1/33 (3%)
leucine-rich repeat 410..426 CDD:275380 1/15 (7%)
leucine-rich repeat 427..450 CDD:275380 4/22 (18%)
LRR <445..>677 CDD:443914 44/233 (19%)
leucine-rich repeat 451..474 CDD:275380 4/22 (18%)
leucine-rich repeat 475..498 CDD:275380 5/22 (23%)
leucine-rich repeat 499..522 CDD:275380 0/22 (0%)
leucine-rich repeat 523..546 CDD:275380 4/22 (18%)
leucine-rich repeat 547..570 CDD:275380 0/22 (0%)
leucine-rich repeat 571..594 CDD:275380 7/22 (32%)
leucine-rich repeat 595..619 CDD:275380 4/23 (17%)
leucine-rich repeat 620..644 CDD:275380 10/23 (43%)
LRRCT 675..723 CDD:214507 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.