DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and tlrs5

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_002937550.2 Gene:tlrs5 / 100489423 XenbaseID:XB-GENE-22201327 Length:653 Species:Xenopus tropicalis


Alignment Length:563 Identity:146/563 - (25%)
Similarity:236/563 - (41%) Gaps:158/563 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LHLERVPVLPSYVQTLHLANNKLNDTTVLE---IRNLLNLTKVSLKRNLLEVI---PKFIGLSGL 339
            ||.|....| |:::.|.|.:|.| |.:|||   .::|.:|.|:.|..|.:..:   |.|:.||.:
 Frog   121 LHPEAFEGL-SWLEVLLLDHNGL-DESVLESGMFKDLTSLKKLDLSFNNIRRVRPDPTFLKLSSI 183

  Fly   340 KHLVLANNHITSISSESLAALP--LLRTLDLSRNKLHTIELNSFPKSNNLVHLI----------- 391
            ..|:|..|.::.:..|.|..|.  .|:.||:|.|.|   :|:|.|...|..:.|           
 Frog   184 SFLLLKFNKVSMLCGEDLQNLQGRRLQLLDMSSNPL---QLSSTPHCTNPFNNITLGTLDVSSMG 245

  Fly   392 --------------------------------LSFNEITNVNEHSFATLNN-------------- 410
                                            ..|:.:.:.|:.:|:.||:              
 Frog   246 WNAEMVENFVRTISGTQVDYIKMRHTAGLGSGFGFHNLKDPNKDTFSGLNSSNVQILDLSNGFIS 310

  Fly   411 ------------LTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQL-EINWSTFRGL--ESMKN 460
                        |..|:||:|:::.:....|..|.:|..|.|:.|.| |:..|:|:||  .|:|.
 Frog   311 HLVPQLFSAFPKLLSLDLSSNQINRMSSGAFSGLGELVSLNLSGNLLGELMGSSFQGLGATSLKT 375

  Fly   461 LQLKSNKIRALQDGV---FYVMHKIETIDLAMNQISSLSRQGL-FNLTKLRHLNLSFNAISRIEV 521
            |.|.||.|.|:|.|.   |..:..:...|.|:|:|.....||: |.|.|...::..:|.||    
 Frog   376 LDLSSNHIGAVQYGALDSFTALTSLNLRDNALNKIPPTKLQGVTFVLLKQNRISDIYNIIS---- 436

  Fly   522 DTWEFTQSLEVLDLSNNAINEFKP--QHLDCLHRLKTLNLAHNRLQY------------------ 566
                |.....:||||:|.:.:|:.  |.|: |..||.|:||.|.|..                  
 Frog   437 ----FCPHATILDLSSNRLTDFRSLWQILE-LQSLKYLSLASNSLYRCSLPHTSNITRTSGLVYL 496

  Fly   567 -LQENTF-------DC------VKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNL 617
             |.:|..       :|      :.:|:.|||.||:||.|.:..     |:.|..|:.|||.||..
 Frog   497 DLSDNALGPVLKSGECGDIFMHLGSLKSLNLARNQLSNIPDTM-----FRSLSSLQTLDLSGNGF 556

  Fly   618 KQISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLNFICDCDLVWFQQWLKNRF 682
            |:|.:...:||..|:.||||.:.|.::..:..:.:..|..:....:..:|||.|..|.:||:   
 Frog   557 KEIQSNLFTGLTALKTLNLGKSNLVTLSSSVLDPLGSLESIDLSEVTLVCDCSLWDFWKWLE--- 618

  Fly   683 PQQAEHAVCGYPEHLLDRHLK-SLSSSELVCVDSPKPRVEQEP 724
                            |.::. ::...|::|: .|.||:.:.|
 Frog   619 ----------------DTNVTVNVGKQEVLCI-QPTPRIPEIP 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 125/466 (27%)
leucine-rich repeat 293..316 CDD:275380 9/25 (36%)
leucine-rich repeat 317..338 CDD:275380 7/23 (30%)
leucine-rich repeat 339..362 CDD:275380 6/24 (25%)
leucine-rich repeat 363..386 CDD:275380 9/22 (41%)
leucine-rich repeat 387..410 CDD:275380 5/65 (8%)
leucine-rich repeat 411..434 CDD:275380 7/22 (32%)
leucine-rich repeat 435..457 CDD:275380 10/24 (42%)
leucine-rich repeat 458..481 CDD:275380 10/25 (40%)
leucine-rich repeat 482..505 CDD:275380 8/23 (35%)
leucine-rich repeat 506..529 CDD:275380 4/22 (18%)
leucine-rich repeat 530..553 CDD:275380 9/24 (38%)
leucine-rich repeat 554..577 CDD:275380 10/54 (19%)
leucine-rich repeat 578..604 CDD:275380 10/25 (40%)
leucine-rich repeat 607..630 CDD:275380 10/22 (45%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 9/47 (19%)
Ig_3 717..816 CDD:464046 3/8 (38%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
tlrs5XP_002937550.2 RNA1 <100..269 CDD:444072 39/152 (26%)
LRR_8 106..168 CDD:404697 18/48 (38%)
leucine-rich repeat 108..131 CDD:275380 4/10 (40%)
leucine-rich repeat 132..157 CDD:275380 9/25 (36%)
leucine-rich repeat 158..182 CDD:275380 7/23 (30%)
leucine-rich repeat 183..208 CDD:275380 6/24 (25%)
leucine-rich repeat 209..232 CDD:275380 10/25 (40%)
LRR 291..632 CDD:443914 100/373 (27%)
leucine-rich repeat 299..322 CDD:275380 0/22 (0%)
leucine-rich repeat 323..346 CDD:275380 7/22 (32%)
leucine-rich repeat 347..372 CDD:275380 10/24 (42%)
leucine-rich repeat 373..396 CDD:275380 10/22 (45%)
leucine-rich repeat 397..440 CDD:275380 13/50 (26%)
leucine-rich repeat 418..431 CDD:275378 3/12 (25%)
leucine-rich repeat 441..492 CDD:275380 16/51 (31%)
leucine-rich repeat 493..521 CDD:275380 3/27 (11%)
leucine-rich repeat 522..545 CDD:275380 11/27 (41%)
leucine-rich repeat 546..569 CDD:275380 10/22 (45%)
leucine-rich repeat 570..591 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.