DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhe and Cel

DIOPT Version :9

Sequence 1:NP_001163166.1 Gene:Jhe / 36780 FlyBaseID:FBgn0010052 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_058693.2 Gene:Cel / 24254 RGDID:2331 Length:612 Species:Rattus norvegicus


Alignment Length:545 Identity:170/545 - (31%)
Similarity:248/545 - (45%) Gaps:67/545 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LQLLLLGQLLAGPGPFCAALATVDQLTVCPPSVGCLKGTN--LQGYQSERFEAFMGIPYALPPIG 69
            |::|.||...      |.|.|...:|.......|.::|.|  |.....:..:.|.|||:|...  
  Rat     4 LEVLFLGLTC------CLAAACAAKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAK-- 60

  Fly    70 DLRFSNPKVMPKLLGMYDASAPKMDCIQKNYLLPTPVVYGDEDCLYLNVYRPEIRKSA---LPVM 131
              ...||:..|...|...|:..|..|:|..  :.....||.|||||||::.|:.||..   ||||
  Rat    61 --TLENPQRHPGWQGTLKATDFKKRCLQAT--ITQDDTYGQEDCLYLNIWVPQGRKQVSHDLPVM 121

  Fly   132 VYIHGGGFFGGSAGPGVTGPEYFMDSGE-------VILVTMAYRLGPFGFLSTQDAVMSGNFGLK 189
            |:|:||.|..|| |.|....:.::..||       ||:||..||:||.|||||.||.:.|||||:
  Rat   122 VWIYGGAFLMGS-GQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLR 185

  Fly   190 DQNLALRWVQRNIRFFGGDPQRVTIFGQSAGGVAAHMHLLSPRSHGLFHRVISMSGTANVPFAIA 254
            ||::|:.||:|||..|||||..:||||:|||..:..:..|||.:.||..|.||.||.|..|:||.
  Rat   186 DQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGVALSPWAIQ 250

  Fly   255 EQPLEQARLLAEFADVPDARNLSTVKLTKALRRINATKLLNAGDGL----KYWDVDHMTNFRPVV 315
            |.||..|:.:|:....|..   .|.|:...| :|...:.|.....|    :.:.:.|...|.|||
  Rat   251 ENPLFWAKTIAKKVGCPTE---DTAKMAGCL-KITDPRALTLAYRLPLKSQEYPIVHYLAFIPVV 311

  Fly   316 EEGL----EVDAFLNAHPMDMLAQGMPTSIPLLLGTVPGEGAVRVVNILGNETLRQSFN--LRFD 374
            :...    .::.:.||..:|.|| |:......|..||.    |..::....:...:.|.  :...
  Rat   312 DGDFIPDDPINLYDNAADIDYLA-GINDMDGHLFATVD----VPAIDKAKQDVTEEDFYRLVSGH 371

  Fly   375 ELLQELLEFPASFSQDRREKMMDLLVEVYFQGQHEVN-ELTVQGFMNLISDRGFKQPLYNTIHKN 438
            .:.:.|....|:|         |:..|.:.|...:.| :.||..|.   :|..|..|....:.::
  Rat   372 TVAKGLKGTQATF---------DIYTESWAQDPSQENMKKTVVAFE---TDILFLIPTEMALAQH 424

  Fly   439 VCHTPN-PVYLYSFNYQGPLSYASAYTSANVTGKYGVVHCDDLLYLFRSPLLFPDFQRNSTEAKV 502
            ..|..: ..|.|.|::...:.....:..|:        |.|||.|:|..|...|...| :.:..|
  Rat   425 RAHAKSAKTYSYLFSHPSRMPIYPKWMGAD--------HADDLQYVFGKPFATPLGYR-AQDRTV 480

  Fly   503 IHSFVDYFVHFAKFGKPRNSESLTP 527
            ..:.:.|:.:|||.|.|....|..|
  Rat   481 SKAMIAYWTNFAKSGDPNMGNSPVP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JheNP_001163166.1 COesterase 40..527 CDD:278561 161/510 (32%)
CelNP_058693.2 COesterase 26..542 CDD:278561 162/517 (31%)
Aes <118..>247 CDD:223730 66/129 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..612
4 X 11 AA tandem repeats, O-glycosylated region 556..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.