DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhe and Nlgn2

DIOPT Version :10

Sequence 1:NP_523758.3 Gene:Jhe / 36780 FlyBaseID:FBgn0010052 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_942562.2 Gene:Nlgn2 / 216856 MGIID:2681835 Length:836 Species:Mus musculus


Alignment Length:31 Identity:10/31 - (32%)
Similarity:13/31 - (41%) Gaps:7/31 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 LLQSAMVTLYTVYLTWSAVANNPDAECNPGF 302
            :||....|..|||..|:.:       ..|||
Mouse    23 ILQLTAATGLTVYAVWAGI-------LMPGF 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JheNP_523758.3 alpha/beta hydrolases 38..527 CDD:473884 10/31 (32%)
Nlgn2NP_942562.2 COesterase 42..601 CDD:395084 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..661
Required for interaction with LHFPL4. /evidence=ECO:0000269|PubMed:28279354 679..699
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..836
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.