DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and AT1G49640

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_175387.1 Gene:AT1G49640 / 841388 AraportID:AT1G49640 Length:315 Species:Arabidopsis thaliana


Alignment Length:165 Identity:46/165 - (27%)
Similarity:67/165 - (40%) Gaps:45/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NVYRPKNRAEDKLPVMVYIHGGGF-----FSGSAHPMASGPEYLMD---TNKVVMVTMNYRLGPF 161
            |..|..:.|.:|:|:::|.|||.:     ||...|      .||.:   |...:.|::.|||.| 
plant    62 NKSRKLDTAGNKIPLLIYFHGGAYIIQSPFSPVYH------NYLTEVVITANCLAVSVQYRLAP- 119

  Fly   162 GFLSTGDEHMPGNFGFKDQRLALQWIQKH----IATFGGDPKKVTVLGHSAG-------GISAHL 215
                   || |....:.|...|:|||..|    |..: .|..:|.:.|.|||       ||.|..
plant   120 -------EH-PVPAAYDDSWSAIQWIFSHSDDWINEY-ADFDRVFIAGDSAGANISHHMGIRAGK 175

  Fly   216 HMISPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQ 250
            ..:||..||:........|          |:|:.:
plant   176 EKLSPTIKGIVMVHPGFWG----------KEPIDE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 46/165 (28%)
Aes <106..>210 CDD:223730 35/122 (29%)
AT1G49640NP_175387.1 Aes 11..274 CDD:223730 46/165 (28%)
Abhydrolase_3 77..294 CDD:285143 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.