DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and AT1G19190

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_173353.1 Gene:AT1G19190 / 838502 AraportID:AT1G19190 Length:318 Species:Arabidopsis thaliana


Alignment Length:338 Identity:79/338 - (23%)
Similarity:125/338 - (36%) Gaps:96/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKEWGLMGVEDCL 102
            :::|..|..:...|..|.:.|   :|.|            .:||:            :...|..|
plant    16 FKNGGIERLVPETFVPPSLNP---ENGV------------VSKDA------------VYSPEKNL 53

  Fly   103 YLNVYRPKN----RAEDKLPVMVYIHGGGF-----FSGSAHPMASGPEYLMDTNKVVMVTMNYRL 158
            .|.:|.|:|    ..|.|:|::||.|||||     ||...|...:.   .:.....:.|::.||.
plant    54 SLRIYLPQNSVYETGEKKIPLLVYFHGGGFIMETAFSPIYHTFLTS---AVSATDCIAVSVEYRR 115

  Fly   159 GPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFG--------GDPKKVTVLGHSAGGISAHL 215
            .|        || |....::|...|:|||..||...|        .|..||.:.|.|||...||.
plant   116 AP--------EH-PIPTLYEDSWDAIQWIFTHITRSGPEDWLNKHADFSKVFLAGDSAGANIAHH 171

  Fly   216 HMISPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAIDQAE------SLSSQDLAEA 274
            ..|..:.:.|...:..::|       .||..|...::.|.:|:.::...      .::|.|....
plant   172 MAIRVDKEKLPPENFKISG-------MILFHPYFLSKALIEEMEVEAMRYYERLWRIASPDSGNG 229

  Fly   275 LR----NV---------CPKKLLVSVDSLKV-----WDNMPHLT------TLPVLEAPSP-DAFL 314
            :.    ||         | :::||.|....|     |..:..|.      .:.|:|.... ..|.
plant   230 VEDPWINVVGSDLTGLGC-RRVLVMVAGNDVLARGGWSYVAELEKSGWIGKVKVMETKEEGHVFH 293

  Fly   315 VEDPLDAHRAGRI 327
            :.|| |:..|.|:
plant   294 LRDP-DSENARRV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 79/338 (23%)
Aes <106..>210 CDD:223730 37/120 (31%)
AT1G19190NP_173353.1 Abhydrolase_3 75..293 CDD:400284 55/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.