DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and GID1C

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_198084.1 Gene:GID1C / 832790 AraportID:AT5G27320 Length:344 Species:Arabidopsis thaliana


Alignment Length:134 Identity:35/134 - (26%)
Similarity:52/134 - (38%) Gaps:34/134 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LYLNVYRP------------KNRAEDKL-PVMVYIHGGGFFSGSAHPMASGPEY------LMDTN 147
            |...||||            :|..:.:: ||:|:.|||.|    ||..|:...|      |:...
plant    76 LLSRVYRPADAGTSPSITDLQNPVDGEIVPVIVFFHGGSF----AHSSANSAIYDTLCRRLVGLC 136

  Fly   148 KVVMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFGGDPKKVTVL--GHSAGG 210
            ..|:|::|||..|       :...|  ..:.|....|:|:............||.:.  |.|:||
plant   137 GAVVVSVNYRRAP-------ENRYP--CAYDDGWAVLKWVNSSSWLRSKKDSKVRIFLAGDSSGG 192

  Fly   211 ISAH 214
            ...|
plant   193 NIVH 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 35/134 (26%)
Aes <106..>210 CDD:223730 31/124 (25%)
GID1CNP_198084.1 Abhydrolase_3 107..320 CDD:400284 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.