DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and CXE17

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_197112.1 Gene:CXE17 / 831465 AraportID:AT5G16080 Length:344 Species:Arabidopsis thaliana


Alignment Length:406 Identity:94/406 - (23%)
Similarity:136/406 - (33%) Gaps:149/406 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IPFAQPPVGP--------LRLKNPVPNEPWEGVL--DAGAAKDSCIQRSYFAKEWGLMGVEDCLY 103
            :|...|.:.|        ::|.    |:.|..|.  ||.||..|.                    
plant    50 VPIVSPTIHPSSKATAFDIKLS----NDTWTRVYIPDAAAASPSV-------------------- 90

  Fly   104 LNVYRPKNRAEDKLPVMVYIHGGGFFSGSA-----HPMASGPEYLMDTNKVVMVTMNYRLGPFGF 163
                        .||::||.|||||..|||     |...:.   |....:.|:|::||||.|   
plant    91 ------------TLPLLVYFHGGGFCVGSAAWSCYHDFLTS---LAVKARCVIVSVNYRLAP--- 137

  Fly   164 LSTGDEH-MPGNFGFKDQRLALQW-IQKHIATFGGDP--------KKVTVLGHSAGGISAHLHMI 218
                 || :|.  .:.|....:.| :::.|:|.||.|        ..|.:.|.|||...|:...:
plant   138 -----EHRLPA--AYDDGVNVVSWLVKQQISTGGGYPSWLSKCNLSNVFLAGDSAGANIAYQVAV 195

  Fly   219 SPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAIDQAESLSSQDLAEALRNVCPKKL 283
            ...:.|.:.|::.|.|.       ||..|.     .|       .||.:|.              
plant   196 RIMASGKYANTLHLKGI-------ILIHPF-----FG-------GESRTSS-------------- 227

  Fly   284 LVSVDSLKVWDNMPHLTTLPVLEAPSPDAF-LVEDPLDAHRAGRINQMPWILSLSSRAGEGSLFI 347
                      :...|.|....|...:.||: .:..|..|.|     ..||...|.|.|| ..|..
plant   228 ----------EKQQHHTKSSALTLSASDAYWRLALPRGASR-----DHPWCNPLMSSAG-AKLPT 276

  Fly   348 MRAFINPKLRAEFN---ENFLEHMALLLNLPEGTPVQMV--------SEILDAYDFKGDSLNNDT 401
            ...|:     |||:   |..||...::.:  .|..|:.:        ..|||......|.: :|.
plant   277 TMVFM-----AEFDILKERNLEMCKVMRS--HGKRVEGIVHGGVGHAFHILDNSSVSRDRI-HDM 333

  Fly   402 MLKLAEISGDFNFYYP 417
            |.:|      .||.:|
plant   334 MCRL------HNFIHP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 94/406 (23%)
Aes <106..>210 CDD:223730 35/118 (30%)
CXE17NP_197112.1 Aes <76..333 CDD:223730 82/358 (23%)
Abhydrolase_3 95..319 CDD:285143 70/292 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.