DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and CXE16

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_568298.1 Gene:CXE16 / 831281 AraportID:AT5G14310 Length:446 Species:Arabidopsis thaliana


Alignment Length:147 Identity:36/147 - (24%)
Similarity:51/147 - (34%) Gaps:52/147 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YRPK-NRAEDKLPVMVYIHGGGFFSGSAHPMASG--PEYLMDTNKVVMVTMNYRLGPFGFLSTGD 168
            |.|. .|...|||||:..||||:.|||:...|:.  ...:.....|:::.:.|||.|       :
plant   140 YAPSAKRNSRKLPVMLQFHGGGWVSGSSDSAANDFFCRRIAKVCDVIVLAVGYRLAP-------E 197

  Fly   169 EHMPGNFGFKDQRLALQWIQKH-----------------------------IATFG--------- 195
            ...|.  .|:|....|.|:.|.                             :..||         
plant   198 NRYPA--AFEDGVKVLHWLGKQANLADCCKSLGNRRVNGVEVKKLNVQGQIVDAFGASMVEPWLA 260

  Fly   196 --GDPKKVTVLGHSAGG 210
              .||.:..:||.|.||
plant   261 AHADPSRCVLLGVSCGG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 36/147 (24%)
Aes <106..>210 CDD:223730 34/145 (23%)
CXE16NP_568298.1 Abhydrolase 85..>213 CDD:419691 25/81 (31%)
Abhydrolase_3 154..411 CDD:400284 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.