DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and AT5G06570

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001330981.1 Gene:AT5G06570 / 830545 AraportID:AT5G06570 Length:344 Species:Arabidopsis thaliana


Alignment Length:336 Identity:83/336 - (24%)
Similarity:126/336 - (37%) Gaps:106/336 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LYLNVYRP---KNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEY------LMDTNKVVMVTMNYR 157
            |:|.:|:|   .||.  .|||:|:.|||||..||    .|.|.:      |..:...::|:.:||
plant    75 LHLRLYKPISASNRT--ALPVVVFFHGGGFCFGS----RSWPHFHNFCLTLASSLNALVVSPDYR 133

  Fly   158 LGPFGFLSTGDEH-MPGNFGFKDQRLALQWIQKHIATFG----------GDPKKVTVLGHSAGGI 211
            |.|        || :|.  .|:|....|.|:.....:.|          .|..:|.|:|.|:||.
plant   134 LAP--------EHRLPA--AFEDAEAVLTWLWDQAVSDGVNHWFEDGTDVDFDRVFVVGDSSGGN 188

  Fly   212 SAHLHMISPNSKGLFQNSMSLTGTMFLSAMK----ILKDPLSQARRLGKELAIDQAESLSSQDLA 272
            .||...:...|           |::.|:.::    :|..|.     .|.|      |..:|::  
plant   189 IAHQLAVRFGS-----------GSIELTPVRVRGYVLMGPF-----FGGE------ERTNSEN-- 229

  Fly   273 EALRNVCPKKLLVSVDSL-KVWD-NMP-------HLT-----TLPVLEAPSPDAFLVEDPLDAHR 323
                  .|.:.|:|:|.| |.|. ::|       |:.     |.|.||:.|.:..||  .:....
plant   230 ------GPSEALLSLDLLDKFWRLSLPNGATRDHHMANPFGPTSPTLESISLEPMLV--IVGGSE 286

  Fly   324 AGRINQMPWILSLSSRAGEGSLFIMRAFINPKLRAEFNENFLEHMALLLNLPEGTPVQMVSEILD 388
            ..|.....:...|....|:...:|           ||...  || ....|.|.....:.|..|: 
plant   287 LLRDRAKEYAYKLKKMGGKRVDYI-----------EFENK--EH-GFYSNYPSSEAAEQVLRII- 336

  Fly   389 AYDFKGDSLNN 399
                 ||.:||
plant   337 -----GDFMNN 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 83/336 (25%)
Aes <106..>210 CDD:223730 36/123 (29%)
AT5G06570NP_001330981.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.