DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and GID1B

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_191860.1 Gene:GID1B / 825476 AraportID:AT3G63010 Length:358 Species:Arabidopsis thaliana


Alignment Length:269 Identity:60/269 - (22%)
Similarity:100/269 - (37%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LNVYRPKNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEY------LMDTNKVVMVTMNYRLGPFG 162
            |.:.:|.:..| .:||:::.|||.|    .|..|:...|      |:....||:|:::||..|  
plant    94 LELTKPLSTTE-IVPVLIFFHGGSF----THSSANSAIYDTFCRRLVTICGVVVVSVDYRRSP-- 151

  Fly   163 FLSTGDEH-MPGNFGFKDQRLALQWIQKHIATFGGDPKKVTV--LGHSAGGISAHLHMISPNSKG 224
                  || .|  ..:.|...||.|::..:....|....|.|  .|.|:||..||...:...::|
plant   152 ------EHRYP--CAYDDGWNALNWVKSRVWLQSGKDSNVYVYLAGDSSGGNIAHNVAVRATNEG 208

  Fly   225 LFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAIDQAESLSSQD------------------- 270
                 :.:.|.:.|..|      .....|...|..:|....::.||                   
plant   209 -----VKVLGNILLHPM------FGGQERTQSEKTLDGKYFVTIQDRDWYWRAYLPEGEDRDHPA 262

  Fly   271 ------LAEALRNV-CPKKLLV--SVDSLKVWD--------------NMPHL--TTLPVLEAPSP 310
                  ..::|:.| .||.|:|  .:|.::.|.              |:.:|  .|:.....|:.
plant   263 CNPFGPRGQSLKGVNFPKSLVVVAGLDLVQDWQLAYVDGLKKTGLEVNLLYLKQATIGFYFLPNN 327

  Fly   311 DAF--LVED 317
            |.|  |:|:
plant   328 DHFHCLMEE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 60/269 (22%)
Aes <106..>210 CDD:223730 30/112 (27%)
GID1BNP_191860.1 Abhydrolase_3 109..322 CDD:400284 50/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.