DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and CXE13

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_190439.1 Gene:CXE13 / 824031 AraportID:AT3G48700 Length:329 Species:Arabidopsis thaliana


Alignment Length:372 Identity:82/372 - (22%)
Similarity:132/372 - (35%) Gaps:140/372 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YQSGEFEAFMGIPFAQPPVGPLRLKNPVP--NEPWEGVLDAGAAKDSCIQRSYFAKEWGLMGVED 100
            |:||..|..:|             :..||  :.|..||:    :||.            :...::
plant    16 YKSGRIERLVG-------------ETTVPPSSNPQNGVV----SKDV------------VYSPDN 51

  Fly   101 CLYLNVYRP------KNRAEDKLPVMVYIHGGGF-----FSGSAHPMASGPEYLMDTNKVVMVTM 154
            .|.|.:|.|      :..|..|||::||.|||||     ||.:.|...:.   .:..:..|.|::
plant    52 NLSLRIYLPEKAATAETEASVKLPLLVYFHGGGFLVETAFSPTYHTFLTA---AVSASDCVAVSV 113

  Fly   155 NYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFG--------GDPKKVTVLGHSAG-G 210
            :||..|        || |....:.|...||:|:..|||..|        .|..||.:.|.||| .
plant   114 DYRRAP--------EH-PIPTSYDDSWTALKWVFSHIAGSGSEDWLNKHADFSKVFLAGDSAGAN 169

  Fly   211 ISAHLHM------ISPNSKGLFQNSMSLTGTM------------------------FLSAMKILK 245
            |:.|:.|      :||.|    .|...::|.:                        ::.::..|.
plant   170 ITHHMTMKAAKDKLSPES----LNESGISGIILVHPYFWSKTPVDDKETTDVAIRTWIESVWTLA 230

  Fly   246 DPLSQARRLGKELAIDQAESLSSQDLAEALRNVCPKKLLVSVDSLKVWDNMPHLTTLPVLEAPSP 310
            .|.|:.......:.:.|:||:....|.      |.|.|::..:.                     
plant   231 SPNSKDGSDDPFINVVQSESVDLSGLG------CGKVLVMVAEK--------------------- 268

  Fly   311 DAFLVEDPLDAHRAG-----RINQMPW---ILSLSSRAGEGSLFIMR 349
            ||.:        |.|     ::.:..|   :|.:....|||.:|.:|
plant   269 DALV--------RQGWGYWEKLGKSRWNGEVLDVVETKGEGHVFHLR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 82/372 (22%)
Aes <106..>210 CDD:223730 39/123 (32%)
CXE13NP_190439.1 Abhydrolase_3 77..305 CDD:400284 60/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.