DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and CXE12

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_190438.1 Gene:CXE12 / 824030 AraportID:AT3G48690 Length:324 Species:Arabidopsis thaliana


Alignment Length:241 Identity:65/241 - (26%)
Similarity:97/241 - (40%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LMPGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKEWGLMGV 98
            |:..|:||..|..||           ....|..:||..||:    :||.            :...
plant    12 LLKIYKSGRIERLMG-----------EATVPPSSEPQNGVV----SKDV------------VYSA 49

  Fly    99 EDCLYLNVYRPKNRA---EDKLPVMVYIHGGGF-----FSGSAHPMASGPEYLMDTNKVVMVTMN 155
            ::.|.:.:|.|:..|   :.|||::||.|||||     ||.:.|...:..   :..:..|.|:::
plant    50 DNNLSVRIYLPEKAAAETDSKLPLLVYFHGGGFIIETAFSPTYHTFLTTS---VSASNCVAVSVD 111

  Fly   156 YRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFG--------GDPKKVTVLGHSAGGIS 212
            ||..|        || |.:..|.|...||:|:..||...|        .|..:|.:.|.|||...
plant   112 YRRAP--------EH-PISVPFDDSWTALKWVFTHITGSGQEDWLNKHADFSRVFLSGDSAGANI 167

  Fly   213 AHLHM--------ISPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQ 250
            .| ||        :||   ||  |...::|.:.|......|.|:.:
plant   168 VH-HMAMRAAKEKLSP---GL--NDTGISGIILLHPYFWSKTPIDE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 65/241 (27%)
Aes <106..>210 CDD:223730 37/119 (31%)
CXE12NP_190438.1 Aes 11..321 CDD:223730 65/241 (27%)
Abhydrolase_3 74..282 CDD:285143 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.