DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jhedup and GID1A

DIOPT Version :9

Sequence 1:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_187163.1 Gene:GID1A / 819674 AraportID:AT3G05120 Length:345 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:61/163 - (37%) Gaps:41/163 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LYLNVYRP---------------KNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEY------LMD 145
            |...||||               |....|.:||:::.|||.|    ||..|:...|      |:.
plant    76 LLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSF----AHSSANSAIYDTLCRRLVG 136

  Fly   146 TNKVVMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFGGDPKKVTVL--GHSA 208
            ..|.|:|::|||..|         ..|....:.|..:||.|:............||.:.  |.|:
plant   137 LCKCVVVSVNYRRAP---------ENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSS 192

  Fly   209 GGISAHLHMISPNSKGLFQNSMSLTGTMFLSAM 241
            ||..||...:.....|:     .:.|.:.|:.|
plant   193 GGNIAHNVALRAGESGI-----DVLGNILLNPM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhedupNP_611085.2 COesterase 31..508 CDD:278561 42/163 (26%)
Aes <106..>210 CDD:223730 33/126 (26%)
GID1ANP_187163.1 Abhydrolase_3 109..322 CDD:400284 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.